CD001LINUX CDROM """k  8$ MKISOFS ISO 9660/HFS FILESYSTEM BUILDER & CDRECORD CD-R/DVD CREATOR (C) 1993 E.YOUNGDALE (C) 1997 J.PEARSON/J.SCHILLING 2007110521011000$2007110521011000$00000000000000002007110521011000$ CD001USRBINUSRBINk  8$SPRRPX$AATFk  8$k  $k  8$CEfk  8$RRPX$AATFk  8$k  $k  8$k  8$SHSCRIPT.TXT;1RRNMshscript.txtPX$TFk  8$k  8$k  8$pk 8$USRRRNMusrPX$AATFk 8$k  .$k 8$fk 8$RRPX$AATFk 8$k  $k 8$fk  8$RRPX$AATFk  8$k  $k  8$pk  $BINRRNMbinPX$AATFk  $k  .$k  $fk  $RRPX$AATFk  $k  $k  $fk 8$RRPX$AATFk 8$k  $k 8$|k 9$ ISODEBUG.;1RRNM isodebugPX$TFk 9$k  .$k 9$|WWk 9$ ISODUMP.;1RRNM isodumpPX$TFk 9$k  .$k 9$|@@k 9$ ISOINFO.;1RRNM isoinfoPX$TFk 9$k  .$k 9$x  k 9$ ISOVFY.;1RRNM isovfyPX$TFk 9$k  .$k 9$|KK  k 9&$ MKHYBRID.;1RRNM mkhybridPX$TFk 9&$k  .$k 9&$|  k 9.$ MKISOFS.;1RRNM mkisofsPX$TFk 9.$k  .$k 9.$|HGGHk  $ MKZFTREE.;1RRNM mkzftreePX$TFk  $k  .$k  $ER TRRIP_1991ATHE ROCK RIDGE INTERCHANGE PROTOCOL PROVIDES SUPPORT FOR POSIX FILE SYSTEM SEMANTICSPLEASE CONTACT DISC PUBLISHER FOR SPECIFICATION SOURCE. SEE PUBLISHER IDENTIFIER IN PRIMARY VOLUME DESCRIPTOR FOR CONTACT INFORMATION.#!/bin/sh ln -s /mnt/plug-in/mkisofs/usr/bin/isodebug /home/cell/bin ln -s /mnt/plug-in/mkisofs/usr/bin/isodump /home/cell/bin ln -s /mnt/plug-in/mkisofs/usr/bin/isoinfo /home/cell/bin ln -s /mnt/plug-in/mkisofs/usr/bin/isovfy /home/cell/bin ln -s /mnt/plug-in/mkisofs/usr/bin/mkhybrid /home/cell/bin ln -s /mnt/plug-in/mkisofs/usr/bin/mkisofs /home/cell/bin ln -s /mnt/plug-in/mkisofs/usr/bin/mkzftree /home/cell/bin ELF 44 (444444PP|@00P0PHHH Ptd??Qtd/lib/ld-linux.so.2GNUC[P"NZB6RE;$5F8)%&X .YH M >'SVCOJUTD@9K+ *0,/!?:=-4(71ILG<QA#3W2<<+r| wzg`?|<'q eZo1%;6W.'6 (z P__X9#H*3kj!X%^Xv]r=1Q`:MhQ'Ԏ+ 0q:b|'[=@VB<~CZ_E63Cʅ# KT^U z9,8|gQE 60_Jv_RegisterClasses__gmon_start__libc.so.6putcharstrcpyrcmdioctlsysconfstdoutstrerrorfdopengeteuidgetenv__strtol_internalusleepgetpagesizefgetsmemcpyglobperrorreadlinkputsdup2getuidmallocfflushabort__lxstatstrrchrisinffprintfstrcatsetsockoptstdinwaitferrorstrstrrandsignalreadstrncmpstrncpyrealloc_IO_getcstrtokforkexeclpgettimeofdaymemsetfcvtseteuidgetpwuidgetpwnamgetservbynamefclosestderrisnanvallocfputcecvt__ctype_b_locglobfreesocketpairfwrite__xstatrewind__errno_location__fxstatsetbufgcvtfopenfilenogetline_IO_stdin_used_exit__libc_start_mainlseek64strchrfcntlsetuidfseeko64fopen64GLIBC_2.3GLIBC_2.1GLIBC_2.0$ii ii ii PY___HQ QQQQQ Q$Q (Q ,Q 0Q 4Q 8QQ?Q@QAQBQCRDRERF RGRIRJRMRN RO$RQ(RR,RS0RT4RU8RVUS[ïRtX[ÐU=_tvhRҡhRu_ÉU,Ptt h,PЃvÐUSà D$X$D$R$s$}$h$$ľ$$UWV}Se gg9~Ӊؙ}D$ ËE|$ $D$3xg$Ut $TiE])DžE[ ^_]É$-D$ Ƹ4$D$T$!Ѓt0]|$4$ \$9t $T[^_]$mUSt]nED$ $D$D$fD$D$ D$P\$E$gD$$菃gD$g$趃gx]%D$gg$zgD$<$4t[g@$$gh$t[]뜀}uD$\$$mt[]ágh$$Fg$U_ug$É$ÐUS]$^t{$~1[]É$讌$訑uۉ$Ցt$ȑt $軑uUS]$t$1҃t[]É$?!t1$2 t 1[]É$U u[]É$;t$/uUVSu^@D$D$l$CF$CTC CCCUV$ЈCUFDĿu[^]UWVS ]C$$lS$BxC$ [^_]ÉS$1$0;} }\$%yNC@@(uՉ$E$}tuC$~BC$1뗃}:ƒ}0 Шt؃k$ [^_]É$M$茊C$UVSu^@4$x [^]0҃{ 4$tI4$Ȏt$ 4$Ey4$讎t&4$衎뙉4$y뤉4$UVSu^@D$D$l$CTCCC CCUV$ЈCUFDԿu[^]UWV}S1҃<[^_]UWVS u}^@D$D$l$jE {CTCC CVCU$ЈCUCXFD4$ڐ [^_]UWVS }uE _@D$t$$D$D$l$E sCTCC CWCU$ЈCUCXGD<$Hx G(u 1҃ [^_]É<$~$)ƋE t$D$躈UVSu^@D$D$l$-CCT%CC CVCUC[$C\ЈCUFD4$蓏xJAYQ A A AY A  ‰1҃[^]UVS ](u J}Eɴ 5,fE 8m\$mm\$ mm\$m4$D$D$@4$D$D$ [^]UVSu^@D$D$l$CTCC CVCU$ЈCU} C\CWFD,4$"[^]UVSu^@D$D$l$<CTCC CVCU$ЈCUE $CXFD?4$谍[^]UWVSEu] EE~@ED$D$l<$GTGG GFWU1ۋ]tGXMtWUFD\u[^_]UWVS u}^@D$D$l$1E {CTC_C^CC CFDl$z4$袌 [^_]UWVS }u _@D$D$l$CC CCTGSU…xICVCWuxDECXECYE$ˆSUGD<$ [^_]CVCWuyCXCYE$ˆSUGD<$Nj [^_]UWVS u} ^@D$D$l$CT CCC CCUV$ЈCUCVFDu [^_]@UWVS }u_@D$D$l$`E EC CT CC CW$‰SUCVCWECXGD<$辊x <$|yU)ƒ [^_]UWVS }u_@D$D$l$E EC CT*CC CCUW$ЈCUCVCWCXCYEC[EC\GD<$x <$xU)ƒ [^_]UVSEu] =MU[^]UME] u[^] UWVS Eu}X@D$D$l$E ECTCC EC CPCU$ЈCUCVCWCXCYCZC[C\C]E@D$xE$wU)ƒ [^_]UWVS u} ^@D$D$l$CT CC CV$‰SUCVCWFDu [^_]]UWVS }u _@D$D$l$}CT+CC CWCU$ЈCUCVCWCXCYGD} [^_]ևUE U=]E U]WUVSu^@D$D$l$CT5CC CCxSUF‹E tSUFD4$C[^]UWVSE} uEEEEX@D$D$l$GECT$E[]==='=t&A=t&>$y=[ &de&>$)=;='t&-c=0=:t&>us$$ ===t&>u3$%A  D$$8<E[]M=Xe=Dv=Et&u$Q == =u$d$t$==J$=3$=&$=$q=Y=$O$C$7$+$$!$2$A{$T$\$p$$$$$$${$o$c$ W$K$*?$93$J'$\$kUVS]C$s@$k$1҅x [^]Ã~ F+$UDžDžDžDžDžDžB<D$$D$D$D$ D$D$_t MA<t E@<t UB<t MA<t E@<Eu h$|U0 J<_$D$$ \)MAu MA<:ED$`$pU9MA<;MA< EMA<UVSu] \$4$31҅t u[^]É4$US$EE] EttD$ED$D$ED$ D$ED$$1҅ttE E$[]UVSӃމT$D$$o肳غ颋.$~)T$a^$ )\$C[^]UWVS,}$<t ,[^_]ÍD$D$$胡D$<$vG$Ɖ\$<$vo$t$É<$R.t$ 谲C< <?$$萲$)覣D$4CuDD$$I\D$VCuDD$$I4D$gCuDD$$I D$xCuDD$$ID$CuDD$$I輱D$CuDD$$I蔱D$CuDD$$IlD$C uDD$$IDD$C uDD$$ID$CuDD$$I$ 躡D$CuDD$$ID$C uDD$$I蘰D$0CuDD$$IpCt(D$CuDD$$IBD${xDD$$ID$JC@uDD$$ID$CuDD$$IʯD$a{xDD$$I袯D$rCuDD$$IzCt(D$$CuDD$$ILD$\C uDD$$I$D$C@uDD$$ID$C uDD$$IԮD$CuDD$$I謮D$CuDD$$I脮$ JD$CuDD$$IPC$ CD$$RD$D$CuDD$$ID$CuDD$$ID$CuDD$$I虭D$@CuDD$$qD$CuDD$$IID$dCuDD$$I!D$CuDD$$I$ 违CfS ¸80CfS ¸LCfS ¸`{AfSC ¸t{C S D$$ЉD$HC<<CfS1$s ҉T$;.|$$FfV$t ډ\$ǫF$$RD$褫غ.$~T$舫^$ T$n;g?$fSCC S D$$ЉD$D$CuDD$$ID$8CuDD$$IΪD$lCuDD$$I親D$CuDD$$I~C .D$CuDD$$ILD$CuDD$$I$D$CuDD$$ICD$$RD$өCD$$RD$襩3$CSD$$ЉD$oC*UE]BUW}VgfffS)ˍ )ω)ʍ 4 [)^ ω_]UU)E )EMY… Шt ]Áf]UWVS}j|rk)t؉ )il]𻵁NEE))؍] C1r- S[^_]Í^=ǯwWfk)t؉ )ilf]𻵁NEE))؍f|U 1BB[^_]Uk)tWMVu SN )iǔ))V))N[^_]UVS0]u xB~7E4$D$ED$Et$D$ E$\D$0[^]ÍE$D$FED$E\$D$ E$D$ڦ념UWVSLDžU$}t E$GDžDžt DžD$D$$t DžG$<$荤D$U T$ T$<$D$+1t G<$D$U T$ T$<$D$G(o$uMSօuz~ j\<$\%)$7T$D$/G(SօtFt$$D$.~kjuFD;$?;E U T$UD$D$@T$ $WG$tUL1[^_]Ão$1ȋED$$D$O9ED$$D$뎃o$끋UD$$T$轑t ~AE$t U$EtfD$D$E$$G$<$̡o$D$U T$ D$E<$D$iG(zEtfD$D$U$跑G$<$_o$D$E D$ D$U<$T$w(]tfD$D$E$JG$<$o$D$U T$ D$E<$D$菽[O(U tbD$D$U $ݐG$<$腠o$D$E D$ D$U <$T$"lG(ucL[^_]ÉED$,D$$褏<$!)‰T$E$7D$+Z<$!)‰T$U $7T$q+q<$!)‰T$E$7D$E+<$X!)‰T$U$7T$+CUD$$T$ԎDžED$$D$誎DžUD$$T$耎DžXED$$D$VDžqUWVSu]}~UFt#FFFxЈV F F C$$jC$tFC$@|$ $<D$Et$$D$x [^_]ËC$C$$ k$@D$ $<D$Et$$D$袽yK$t 1[^_]ËE D$d$D$1ED$t$$.?)1U$莂UWS1щ $@t \$$莓[_]U1҉WVS,}tE M EM14tu[ȋU …tE ^1}tU ,[^_]þ$D$ .uu\$ D$D$$覚J$耂>u6< <  ШuD$ $蔍G`.^< <  ШuD$ $J.^< <  ШuD$ $.S^< <  ШuD$ $謌 "u C"uCu.U DM$辌 $.EDžTDžP$V$D$tD$$ԉV$ D$ D$ D$$肍D$$qD$ $3D$ $D$ $u$5t$cD$ $芊.D$ D$ D$$i$D$,SD$$B:UWV1S1҃t<[^_]À?uEU<[^_]ÍE<$D$DŽtڀp€P Шt.E1EU*€x Шu$t딀t€T ШtSE1뾃9EȋEUeȉU܋UE؋]܋EUE̋MÉM]܋]܉]5g€G ШtEUSm€M ШtEU/f€F Шt0 iM0 eUs€S ШtEU k€K ШtEU b€B ШtEU w€W ШEUqUVSU EEËE ։ؙ1؉1 u E [^]É\$t$ D$8$薅EE [^]UEUEyM QEUR]U(E D$D$$D$gD$D$ D$D$x1Ut3@ ~,D$$uË StU1]UWV1SEUE} EEPh~59~\$ދED$$誓UBh)9}&)D$ED$E$~~9|ڃ[^_]ËUE[^_]UWV1S,}2)=}Í\$$ 9|ʁ,[^_]UWVSUEƉEE E9u5_hx2P> tN9uwɋU[^_]AEt+F ~ED$$D$kYČ[^_]ÍUD$P$FED$P$rUD$ D$ D$$1~+VtugE1D$$*E$F ~(UED$T$D$ UE$D$蟁辄U)=~-E눉c0UWVSEEEE E1}эYZ\$E4$D${9t EEEE[^_]UWVSl}Wht8E uD$ D$D$P4$諏ډt$$Al[^_]UMQhtD$$ UMQhtD$$UWVS,E] uHh1ɋ} u'1 u1 u~,[^_]Ë.x㋁tى\$ |$t$D$D$ D$$膎E\$$U1WVS}] Ohڅ u~ 1[^_]Ë1\$ H$D$D$D$\$$'[^_]US]Clu$ChCltx u[]É$q҉D$/$2>[]U1WVS}Wh2E ]D$ D$:D$P$N\$$@EPWh]9E|r9]E E $詄GlČ[^_]D$\$ D$D$4$_E-E=‹Wh9.wO ~D$D$G$|}WhEGD$\$ D$D$4$yfE-E=ƋWh9. W .D$D$T$|<$Č1[^_]ËE맋E%UWVSl}Wht8E uD$ D$aD$P4$艋ډt$$gl[^_]UWVS }Wht4u}u\2x u 1 [^_]ÉD$%$nËGhǀ4$_~Gh [^_]É$蔁Whǂ덉$}Whǂi$cWhǂEUWVS]|EE$D$tD$ D$P\E\$$yƉ$~1tEt$$؃|[^_]U1VSuM ^ht t v 1[^]$tAta΋t6뼸 S뵸fS뮸mS막$^h릉$^h뱉$^hUSd]$D$P$D$ D$ D$]~d[]UWVS|}Wh_@G,CDžD$DžCD$C D$CD$CD$D$@D$ $興ƋC D$D$CT$轈s CH|t$D$$s9t +~3D$D$$s;t $ƅC)CaC QC$AC(1 CLCL~-D$C+$$F1C>tt$$~1|[^_]ËC.=@D$D$$#Dž^1C 됃 CL "UWVSDžUEr,@z Zƒ Шd[u^hM u D$:E $3yE pE hu D$D$t$ $ʅD$:$x|t |D$ $ Eyg߅D$@$x)=v\$D$ D$D$$~/tE@ ~-|$gtT$ D$$D$v$xp`$kxd|ugۉl0]4${)D$D$D$ ${wZ$wD$$ytD$$y$!u$zxuFtu!Ĭ[^_]$YuL\$|$D$ D$T$ $腃볋UBttD$D$$a$w‰Fh1.xBǂǂǂǂǂǂǂ$Pv$zׅnUBh8B S|oD$ D$D$P$\$$ExgE hEEËE\$D$ ht$E$_UBhDžǀĬ[^_]D$$ugw$ug3D$@$r$rgtIDžpt$D$$\rxDžl-D$1$lrB$vtvW9t$rxv}x9tG$tPtp$vwD$pD$gtT$ D$g@D$$vuFtsD$hwD$$Mt$Kq%GD$$cD$+qD$$sD$$sD$$oslD$/$utXD$pt$tD$ zD$\$D$l$Rtlt$$}wpQ$@UUM tM UH]St~St1]øSUWVSE`TE ]`Ttu t=U $T$UR xCD$ C D$C$D$a\[^_].tE볋EUE]JUVS] u\$4$P9É ШtˉNT^X[^]UVS] u~\$4$9} 1[^]Ë\$4$PFp[^]US]$PCp[]UE]J UE]J(UE]J,UE]J0UU EPd]US$]E$D$@|hD$ $etaD$I$t $[]D$$uD$E$߄uD$$˄1҅t$ksUEP@B uJ$uz(u1z+t]UE]@@@UE@@Px@])Ë@]UWVSEEuX@C(D$t$D$ E $H|xe} )ǀ{(xi{)C(vLC(f%f=ET$ D$ D$t$<${x+U [^_]$HC)D$t$D$ <${.x)ƀ{)pC*D$t$D$ <${.x)DE[B?055+!Nc sUWVSE] uD$ D$\$E$zxV}(UD$ UD$\$<$zx3)ÃyD$\$<$zx+U[^_]Ã[^_]UED$D$ED$ E D$E$3UWVSE}u X@C~Ct +E [^_]ÉD$CD$|$D$ 4$z….xҋu C)փd~dD$D$|$D$ 4$….xUE@@P TD$D$ ET$D$E $kɉ!UWVS|EEux@G t:t*]D$ D$D$@$yڋMADt8tEEM T$D$D$ t$L$G$$Sx9] )ËEt$\$$x)ƃ G(u+U |[^_]ËGLt$$D$ G+ED$.x)ƍG(D$MED$L$ t$\$$W.x땅GMbD$EH`Y؍])‰T$D$D$@D$ $wMt$\$ $J.)U1҉WVS,}]G(~oG@@D$GD$G D$GD$GDD$4\$D$ E $awx,u )É<$Ɖ\$t$x)Ã(+U ,[^_]É\$t$<$.xƉ+U US]K|+St$L$)ЉD$&C|[]UWVSEu X@$NjC~Cu +E [^_]ÉD$C|$|$ D$ED$xD$4$sv….xNju )Uփd~dD$D$4$D$ ED$….xUMbWVS}uG@@D$O`Y)‰T$D$t$D$ E $ux] )Ã(+U [^_]Ét$\$<$.xUWVS}]<$M tE 0t2G$~W(t'E<$D$ED$xq])EËG$~G(t7G@xt+|g@D$$D$ ED$ux,)EG(~*E\$<$D$xÉ+U[^_]ÅyG$ɋED$ $D$t.x)EG@nUWVS]Es${(C$C(D$ E $D$D$s${([^_]UVSEu D$\$$~D$\$4$\4$g[^]UU$D$US]K|+St$L$)ЉD$ ED$ C|E[]US]$][]UVS]D$t$$~$D$t$$[$f[^]UWVS }u]E D$D$D$D$<$DryE } [^_])rUED$ E D$ED$_$UVS EX@$ƋC~Cu [^]ÉD$Ct$ t$D$_D$x$qd~dD$$D$` [^]UMbVS ]C@@D$K`q)‰T$ D$D$_$5q{( [^]]$ [^]\USEX@C~Ct[]ÉD$ CD$D$_$pCd~dD$$D$[]UE@@P T$T$D$YUWVS }E u]D$D$<$Wpx'B^w/T$D$<$0pyE } [^_]pD$<$pUED$ E D$ED$_$[UWVSE] uD$ D$\$E$MpxX}T$ D$\$<$*px5)Ãx8EEB^vD$\$<$oyˉƒ[^_]D$\$<$o.xۍ+U[^_]UED$D$ E D$E$qUE D$ED$_$UE]@@@(UVSEX@$n1҅tC+$F$.LF >1e>F$uF #F UEU tUt~Tt1]ø%UU(E D$D$$D$8D$D$ DD$D$Q1K1UWVSEPhEEEB EE}Ph17DZx$fYEPhfDZ~׃E}~ȃEm老}~>t"$p\UBhǀǀ1[^_]UWVhS]t$$\$Yux%=`t 1ļ[^_]Ét$\$$PZux%=XD$\$$[y E1󫍅XD$K$[Et4D$K$[Dt t~ڃt&t-Uȅt&duBeu BvuB\D$M$=UD$$)UD$$UD$$UXD$$D$V@=KƄXf1WX/I߹򮍽XʹэL $W \$$[򮋅р|/D$/$u\$D$PU$VD$|$ \$D$U$Vo<$Jb$ KUƉBh1.Ydždždždž fdždždž1E~ 1ۋEMph1ҍfDF~~m~U\$D$T$UD$T$ $GVD$$;xtED$ ED$ED$E $EEUD$ E$D$ED$3EE!D$$UUBt>tU D$D$T$ $U1Uz >~"D$|$ \$D$$TU$%KUBtD$ $TvU]U1VSU w5EXh1t)11ҍf|Cy~~1[^][^]U1VSM ]u u71 u&!EPhtDB[^][^]UD$@E@t$4SUEP@hP $t1҅‰]U1U tBwE SU]J]UWVSuF^@x{ ~C C$1ҁČ[^_]ÍExD$D$,$eED$D$@<$MECCDECtEC 1҅~DTD9S CEȋEċC@ƅ8iCD$S}ЉE܍ED$F$I Ct43M9t+EȋS9vЉD$L$4$HEȋS9v)ЉCC xC(CE$EtCLxC+|C/EC3EC7EC;EC?ECCEC(CGE@tuC C( u,C$tb.+ƒ  к. PC$~ |$D$d$PUЀ:uztC$UWVSU] t3rht0Rx9t%t~A@Utt;1[^_]ÃU.t~Uu߃[^_]øU~U䋶 .xQ)ڍRȹhЉ)‰T$ )ډi'U)É؉)L$ED$D$D$ $gyPg9US$] D$D$$D$>D$D$ D$D$5$D$D$D$>D$D$ D$D$4E\$$=$D$D$D$>D$D$ D$D$Qw4$[1]UWVSÃLUUu}xDЋM)‹E UttL[^_]ÍEMD$SD$ $E1҅u֋C ~$ED$|D$ ED$$CNED$SD$E$EẺUԉMЉE؁{ U~0D$EԉT$D$ EL$D$D$$MEUM EԋUЉMtE܉.U؉EgUWVSEPhEEE9tLfDŽBE}17DZx$?AEPhfDZ~׃E}~ȃEm䀁}~>t"$IDEPhǂǂtXxNfDŽBE17DZx$@EPhfDZ~׃E}~1[^_]USÃD$$B$D$D$B[]UWVS<}Gh NBE EEEE1kUt$ T$U<$T$P$.x׍EED$r"D$$C.xE9E~ED$u"D$$B~E}{E}cE ;EEEE1kUt$ T$U<$T$P$.x׍EED$r"D$$fB.xE9E~ED$u"D$$?B~E}{E}cEE1Ut$ T$U<$T$P$xcED$r"$D$AxH_ ~6EUt$D$ET$ D$ED$@D$$JE;E}EqE}aE}I]Gh>yt6xW;t x ؃<[^_]ËU 9|U t&UWVS u} F ~|$D$ $\I>Í8$A1tFhVlډЃ [^_]US]Clu Cl[]É$j@Cl[]U1VSU w5EXh1t)11ҍf|Cy~~1[^][^]U1VSM ]u u71 u&!EPhtDB[^][^]U]US]Sh9CtAu3ED$"ED$C$a?x 1Ƀ}[]UWVSLE] PhpE9PtBE}D$"|$4$?x1҅ttstKL[^_]ÍU1ׅEPEZttL<ƒL[^_]E|$D$"4$>1҅yEt&׉T$D$4$:USÃU$2<‰U҉Ut ЉEED$"$D$>x[]$"8[]UWVSP4|$D$$;x%=`D$<$<D$D$<$u~_ ƉE܅~rEt$D$D$ $nDu܁vN1L[^_]1ҋ_h9t%SfufSЃE.twU.xEE.xMȋ_hЍf|CEYMԅ-;uMȍfDCE؉$7?frmǀ ED$"D$$:.*Ghu G,QD$)ڍRȹhЉ)‰T$ )ډi'U)øQ؉)L$ MЉ$L$B;U  E;EU؉=GhU؉G1{U؉Gh'U؉MfLCUWVSDžPDžLUBJ Z=X\ƒ` Шu~+6MQtn[^_]ËE tUE tKqÃAuU BTu BAuBuDžLE MAhL`} tM 9uwX1\u]L1P1ۅ1P~ UBttPP~ UBttE M 91DžT} M D$ $'=7TډD$`D$D$\D$ D$X$El`UD$ \$D$XD$`D$\TD$Xډ$EL$ rEDžDpPx Hƒ Шu H"4MAt>t*H|$t$ T$D$ D$$@PEX DžTDž<UT1ۋBhHL$D$>D$ $?<1EPh7DBft0Tt$D$\$ T$D$RM$>~~TtM D$D$L$ $>13gu `U BaTGDžT8MD$D$L$ $o1ED$D$$D$ $}d1E1..D$4$4x{`ډD$\D$ D$X$E.\Xy`PE.4tUBt>tD$D$$=1.t.ttMAt>tt$ D$D$$@=E$ 3WEHh1f fAyUB ~&D$D$$6<EHh>y ǁE t U :1 _HQ19`U|$ D$$D$ N<MD$ $2EHPh>f\B$ v01ۉEɉHh.O1Lǁǁǁǁ fǁfǁǁDžT1T1fDŽQ12fDA~~ჅTT~`D$ D$D$\$D$XD$ ;WUB,>tD$$9:ME TD$ $TED$D$D$ $-E1D$4$0dD$"$D$17FڃaD$ `D$\D$X$Em\Xy`PEt 4OM $/UBt>tD$D$$9$-뮋UBt>tD$D$$m9-.z.p.f ])hDžHD$D$ D$$,hD$T$ D$$$+lDž@tƍFD$ D$ D$$-D$4$.SEDPhf\Bl@t @4uh $-D~ UBtt} hM 9\H1.D$ $?.1} U Dx1 MAhHf\PL$ |$D$E$DDTUMBtu1@UBttM L$ D$D$$$7΋MAt>tD$D$$6/+..UBt>tt$ D$D$$6h $y,KDU$fUWVS4Dž@4Džr@0~ 4Yh9AV4;P4t04Zh;,(4@ ~)FD$ D$ D$4$5V~l4YhtV,(;~4) [^_]ÉЃ$)(V$,_$FDž $$$$ D$D$$,$&,$  Q4AhQ,H61D2T,D $9|Fu),T8$9tFT$D$$4~_$\$,T$0 $'9t!\$ D$4BD$,D$X%4Ah9,@ D$T$0 $+OFt",$;tFD$$D$4,B F F$z pFF)$F,x4B(~FB ~?,AD$A D$AD$AD$ D$TD$$24P49Vt 01[^_]Í$F,xbF+N(FLD$D$,$3V$,F$ F F$yHAX<$&4X ‹@XD$ BhD$D$$14Yhw.F(8D$D$l$#F+8FDž@<DžHDžDƅVU$ЉڈF4x F+TFLTD$$(D$,$1(,NDž 4$|~!4A`9|Mt@F H4B`uF(F$F "4Xh9H}F$F 4P40UWVSlEE]Cs@xChf~'l[^_]F F$1l[^_]Í}D$D$@<$!ESF>EF EFEFEEFTEF+EiFMEĉ|$D$"C$l&NjC ~|$D$ $.iEԈF(E׉FLK ~&EډD$ ED$D$$.E؃vFE E$eC`U9}LF$F F tF$uF$E܉F1E1~EF 볉$~~C`uF(F 독ZEtV$uF$~+i~(_FLuFL~-~7u{~8uuF(F+FL'?,F$ƒ Шt ChfxCN$ƒ Шu RxxF(fǀGUEU tUt~Vt1]øCVU$!1U1]UD$${UD$ $ZU%!U !1U 1U]U1]U]U]U1]U U ÐUU EP4]US]C\uEC`uMC@uUu]ueChum$0Ctuu][]"$"C`t$"C@t$"t$"t$v"Cht$g"$軭Ctt$P"][]C"US$1҅D$D$$SD$ D$D$$CC4CL$uC\$^C`tp$lKC@t]$8CttJCxC|_$$t $څt[]É$1[]US]$$1[]UVSut5`T$8{t$$P趕t$$P$1[^]UWVS\DžDžE DžDžDžtE UP EC,Eƅt U:9t5_D$h$(D$ D$D$$M1}U~4CD$C D$CT$D$DD$ _$($D$赩څ\[^_]É\auquVD$:$h u7+u~t$U$T$Ƅ5G<@D$,$W.1DžDžDžDžDžDž1:c)1ҁ\[^_]ËU_D$fT$$"&uRCD$C D$ CD$D$_$%D$ D$D$TD$uD$_$%덋BDžDžDžD$D$D$ D$E$D$UEB<(<: ШtSD$:E$t6D$:$. Uƅ D$U$T$;EDžDžD$,$8@E .D$UT$E $$1E t Ct$R1<,iD$4$S8EE .kt$ D$ED$U $;$1H} t8D$D$D$D$ UT$E $#$D$8,E .tыD$D$ UT$E $#B瀽DžDžD$E$D$(ED$ D$UT$E $"A9. $D$0,„ Шt8t1G $D$]8u-(} .sD$D$ u .PD$D$ zUWVS]u }uUCs{ S[^_]ËE|$t$$D$ R$UsC{ S[^_]ÐUWVSME] ɋ}1t9tdu W~݃@MpU1u"9\$ D$ED$<$9![^_]B;EuB[^_]É\$ D$UT$Ń W.UEwNVAED$8D$ ËED$8D$ 벋ED$(9D$ =V. WUWVSEEEEEDž|DžxDžtDžpDžlDžhDždE9u $E |$D$E$ xσ [^_]UWVSEu} uE t:E)Dž~/t$|$E$d}Et[^_]ËE[^_]ËE$UEEED$ED$E $1Ʌt;ED$D$E$ 1ɅxET$$D$`ÐUW1VSE] €  Шu+-Uu0E t"A< w30;E}} uދEtߋE 8[^_]ÍAq<< Ш.tω<w7W뤃 qE _E x€X ШSE cU E D$D$E$U ED$E$MU ÐUWVS$EE}E €  Шu+-Uu0E EE؉ULp;u}uE]ue]܉щEЉً]]EЉUEMԋUUt4A< vAY<€ Шtpvp;u|Et ]U]E UMH$[^_]Ã!EEx€X ШEU E D$D$E$mÐU$ ¸tEBE B@j@j1US@j]tB$D$R@j£@ju$UWVS u"$4$$… 1Ҩu [^_]UWVSÃL!xN4$tbU T$UD$|$T$ $:u L[^_]É4$L[^_]ËE D$ U|$$:T$Eȉt$ D$:D$$EwUEUD$E $16US]  U\$$1[]UEUD$E $US] U\$$¸[]UE D$:D$ ED$_$ ÐUVSM EUxt y؉ É ÉЉу‰~?yӃ~ [^]È[^]ÐU<,„ кtÉL$$;ɉUVSEAu_€- Шu1=[^]UWVS\E] :<-<-<+t{DžDžDžuIUDžE ?-M}tM EPB< Ȩt DžU -\t:$^D$t& +1;tK빃: uv{uF<, ШtыE<+=1tu1;u<&tV,1t7&1}t ,1uɋu;t *H?$;{t&,1t7&1}t ,1uɋEM <VB< ȃEP;.G;u.=~,v0Nl€L Ш$Fu+&1}t ,1uɄtEt u1;}|;}`^y>t߀,„ ШuȀi€I Шul€L ШF;|DŽfDŽYƄw-+!E1.M Dž;-bDž{K\[^_]À~ ;Qvs€S Шt Ffc€C Шt FlVB< ȨD$$.1;.;.8ZuF<+t+BxFWN,„ ШtAi뷀l€L ШtNFt$$v؃[^_]D$ D$D$$tD$$j뭉 _D$E $xu1늋E $1xUWVSEUB:EEBX~EUJuR$xM4$L$׃yED$E$׋UBtM$ L$׃yE[^_]USӋR ȃ`_uS []USӋR ȃ`_uS []USӋR ȃq_uS []UWV}S_ 1҃`_Ɉu_ [^_]UWVSEEB}EU1FуMV,M~ E+}~}t,~$ t&V(:tED$$V(UV(:uFuF$x؋U$T$UyF,t~$ tsE>E$0D$UmyUtMEL$$UUu^tM$ L$UyE[^_]ËV(:.tML$$V(UV(:uaF9)ȉEvUVSø<t1N؅x&ȋVx t  yF[^]CUWVS DžDžEU uDž%M $L$U<%u׍ƅ1҉DžDž DžDžà w$<Ĝ [^_]À*DžӃDBЉC< v݀.Dž$<|$<U$<|$|$$<ƅIt)>$<‰D$BCwC$ =0EEۉMDž$<|$DƅI+9r_E D$$U9rDEE DžEE€D ШEEH ʉEE9MɉUtE܉EEEUMHEU0^_É;}vUM̉UMEUEU0^_ǃEua9}w9urŰE)E܉ŰUtE܋ỦEUMEUQ녅u 1ƋẺE܉U= +EԉE؉MMM׊M؋U E̊ME̊M؋E ẺE̊MUe;ỦEw uE9Ev M)MȋEM̋E+EщM̉ʊMMԉE ‹EUEUWVS [vZ E)19s׉M)F9Ήr [^_ÉUWVS[% ) pNu. [^_ÐUSRPP vЋuX[US[ÿPY[Usage: %s [options] image Options: -help,-h Print this help help,h,version,i*,dev*MKI ISO-9660 image created at %s Cmdline: '%s' Cannot open '%s' ISO-9660 image not specified rbBad Argument: '%s' Bad Option: '%s' linux-gnui6862.01isodebug %s (%s-%s-%s) -version Print version info and exit -i filename Filename to read ISO-9660 image from dev=target SCSI target to use as CD/DVD-Recorder If neither -i nor dev= are speficied, is needed. Only one of -i or dev= allowed Read error on old image Seek error on old image . %s%sCannot open SCSI driver. Cannot get SCSI I/O buffer. test unit readyrezero unitrequest_senseinquiryInquiry Data :read capacitySectorsize: %ld Bytes medium load/unloadprevent/allow medium removalstart/stop unitset streamingscsi_set_streamingset cd speedqic 02write_g0write_g1write_g5seek_g0seek_g1flush cacheread bufferwrite_bufferread subchannelread tocread headerread disk inforead track inforeserve trackreserve_track_rzoneread dvd structuresend opcclose track/sessionread master cuesend_cue_sheetread buffer capBFree: %ld K BSize: %ld K blank unitscsi_format: preparingformat unitscsi_format: running- [unable to fork()]mode sense g1Mode Sense Datamode sense g0Mode Sense Data (converted)SaveSet %s Mode Parametersmode select g1mode select g0Cannot read TOC header CD-Text len: %d wctbcdtext.datCannot read CD-Text header Cannot read CD-Text Cannot read TOC TOC data: ENT: B0 lout: %ld B0: B0 start: %ld tocheader: Session info too big. Pages: 0x%X Density: 0x%X Blocks: %ld Blocklen:%ld read_g1capacity_not_setread_g0Device type : Version : %d Response Format: %d Vendor_info : '%.8s' Identifikation : '%.16s' Revision : '%.4s' Capabilities : SOFTRESET CMDQUE LINKED SYNC WBUS16 WBUS32 RELADR TERMIOP AENC Device seems to be: Adaptec 4010Kodak PCD-600Sysgen SC4000Matsushita CW-7501Generic mmc2 DVD-R/DVD-RWGeneric mmc CD-ROMMissing Entry for dev %dPioneer DVD-R S101Plasmon RF-4100Emulex MD23Sony CDU-924SGeneric mmc2 DVD-ROMPhilips old CDD-521Ricoh RO-1420CPhilips CDD-2600Sony SMO-C501Adaptec 5500Generic NON CCS DiskAdaptec 4000Adaptec 4070Philips CDD-2000Maxtor RXT800SMatsushita CW-7502unknownBerthold HR-ScannerRicoh RO-1060CAdaptec 4000/4010/4070Generic CCS DiskAdaptec 4520AGeneric mmc CD-RPhilips CDD-521Yamaha CDR-100Emulex MT02Adaptec 4525Emulex MD21Microtek MS300APhilips CDD-522Yamaha CDR-400Pioneer DW-S114XGeneric mmc CD-RWGeneric CD-ROMTeac CD-R50ScaddythisTry to load media by hand. CD capabilitiesInquiry Data : RXT-800SACERCREATIVEGRUNDIGJVCMITSBISHMITSUMIOPTIMAPHILIPSIMSKODAKHPPINNACLEPIONEERPLASMONPLEXTORRICOHSAFSANYOSONYTEACTRAXDATATraxdataT.YUDENWPIYAMAHAMATSHITACDS615EBERTHOLDEMULEXADAPTECCR-4020CCDR2000CDD521/00CDD521/02CDD521CDD522PCD225KHSW/OBCDR-240CDD20CDD26C4324/C4325CD-Writer 6020CDR100IPWXR-W2001XR-W2010R2626CD-R 650ACB-4520ACB-4525RCD-1000RCD5020RCD5040RCD 4X4CD-WO DW-S114XCD-WO DR-R504XDVD-R DVR-S101RF4100CDR4220CD-R PX-R24CSRO1060CCD-R2004CD-R2006 CD-R2006PLUSCD-RW226CD-R4012CD-R CDU92CD-R CDU94CDR4120CD-R55SCD-WO CRD-R24SCD-WO EW-50CDR10CDR200CDR400CDR-632PCD-R CW-7501CD-R CW-7502 %s: %5d kB/s (CD %3ux, DVD %2ux) 32162424 (I2S)traypop-upreserved(3)disc changercartridge changerreserved(6)reserved(7)CLV/PCAVreserved(2) Drive capabilities, per MMC page 2A: read CD-R medianot Does %s%s write CD-R mediaread CD-RW mediawrite CD-RW mediaread DVD-ROM mediaread DVD-R mediawrite DVD-R mediaread DVD-RAM mediawrite DVD-RAM mediasupport test writingread Mode 2 Form 1 blocksread Mode 2 Form 2 blocksread digital audio blocksread multi-session CDsread CD bar coderead R-W subcode informationreturn CD ISRC informationsupport C2 error pointersdeliver composite A/V dataplay audio CDsLoading mechanism type %s: %s Is %s%s support changing side of diskMaximum read speedCurrent read speedMaximum write speedCurrent write speedBuffer size in KB %s: %d Write speed # %d: %s MMC-2send digital data LSB-firstLength of data in BCLKsRotational control selected MMC-3Capacity: %ld Blocks = %ld kBytes = %ld MBytes = %ld prMB scsi_format: post processing %d Formating in progress: 0.00 %% done. Formating in progress: %.2f %% done [%d]. Formating in progress: 100.00 %% done. Mode Parameters (un-converted)Cannot load media with %s drive! error: %d scb.chk: %d sense_count: %d sense.code: 0x%x restart non-streamed digital audio reads accuratelysupport Buffer-Underrun-Free recordingread fixed-packet CD media using Method 2return R-W subcode de-interleaved and error-correctedread raw P-W subcode data from lead inreturn CD media catalog numbersupport ejection of CD via START/STOP commandlock media on power up via prevent jumperallow media to be locked in the drive via PREVENT/ALLOW commandcurrently in a media-locked statehave load-empty-slot-in-changer featuresupport Individual Disk Present feature Number of supported write speeds: %d Number of volume control levelssupport individual volume control setting for each channelsupport independent mute setting for each channelsupport digital output on port 1support digital output on port 2set LRCK high for left-channel datahave valid data on falling edge of clockCopy management revision supported:zD7Mb? ATIP start of lead out: %ld (%02d:%02d/%02d) ATIP start of lead in: %ld (%02d:%02d/%02d) Mode Page DataCannot get default %s data. Cannot get %s mask. Cannot get %s data. Cannot get saved %s data. Mode Select DataWarning: controller returns wrong page %X for %s page (%X). Warning: controller creates hard SCSI failure when retrieving %s page. Warning: controller does not support %s page. Warning: controller returns zero sized %s page. Warning: controller returns wrong size for %s page. Warning: using default %s data. /etc/cdrecord.conf,:/@%s=CDR_DEVICECDR_DEVICE=CDR_FIFOSIZEBad fifo size environment. CDR_SPEEDBad speed environment. CDR_SPEED=CDR_FIFOSIZE=Bad fifo size in defaults. Value %lld is too large for data type 'long'. REMOTE:rscsi@host:1,2,0rscsi@host:bus,target,lunREMOTE:Remote SCSIRSCSIProtocol error (got %s). Remote status(%s): %d '%s'. R%d A isatapiI initiator idT%d %d %d %d filenoB%d %d havebusF freebufM%ld getbufsndsize: %d rcvsize: %d D%ld maxdmacloseV%d versionS%d %d %d %d %d sendcmdREMOTE%.*sRSHdup2 failed. Illegal remote device syntaxO%s opentcpshellCannot create socketpair. /opt/schily/sbin/rscsiUnknown user: %s rshshell/tcp: unknown service setuid(%lld) failed. seteuid(%lld) failed. -lexeclp '%s' failed. Lost connection to remote host ?? locuser: '%s' rscsiuser: '%s' host: '%s' Warning: Using remote SCSI interface. Illegal value for busno, target or lun '%d,%d,%d'who are you? No passwd entry found. Cannot get connection to remote hostrcmdsh: fork to lose parent failed. }7777777kYGyesYESstatus: 0x%x Reserved(%s%s) host adapter detected errorBUSYINTERMEDIATE GOOD STATUSRESERVATION CONFLICTCHECK CONDITIONCONDITION MET/GOOD %02XSense Bytes:Write Data: CDB: retryable errorfatal errorerror: %d%s: scsi sendcmd: %s no errorReceived Data: resid: %d DMA overrun, %cvendor specific %d unknown device type 0x%xRemovable not present unsupported reserved unsupported TapeWORMProcessorPrinterunit not presentWell known lunAutomation/Drive InterfaceObject based storageBridging expanderOptical card r/wSimple direct accessEnclosure servicesStorage arrayIT8 2IT8 1CommunicationJuke BoxOptical Storageunknown/no deviceSCSI ALREADY RUNNING !!INTERMEDIATE CONDITION MET/GOODSending %d (0x%X) bytes of data. SCSI command name not set by callercmd timeout after %ld.%03ld (%d) s Executing '%s' command on Bus %d Target %d, Lun %d timeout %ds Got %d (0x%X), expecting %d (0x%X) bytes of data. cmd finished after %ld.%03lds timeout %ds Cannot send SCSI cmd via ioctl ret < 0 errno: %d ux_errno: %d error: %d Currently running '%s' command. !!!!"!!!!!!!!!!!!!!!!!!!!//////00000}0p0c0V0I0<0/0%0&/&/&/&/&/&/&/&/&/&/&/0/scgo_send(%s) wrote %d bytes (expected %d). DMA (read) overrun by %d bytes (requested %d bytes). ATA Packet specific SCSI transportEXAMPLE: /dev/scsi/host1/bus2/target3/lun4/cd EXAMPLE: /dev/ide/host0/bus0/target1/lun0/cd EXAMPLE: /dev/hda or /dev/sr0 ERROR: in scgo_get_first_free_shillybus(...). Too many CDROMs, more than %iIncrease MAX_SCHILLY_HOSTS in scsi-linux-ata.c and recompile!ERROR: unknow subsystem (%s) in (%s) ERROR: this cdrom is already mapped %s(%d,%d,%d) INFO: subsystem %s: h %i, b %i, t %i, l %iERROR: with link merging! base %s link %s, result of merging %i ERROR: with link reading! link %s, result of readlink %i INFO: /dev/%s, (host%d/bus%d/target%d/lun%d) will be mapped on the schilly bus No %d (%d,%d,%d) INFO: Bus: %d Target: %d Lun: %d Chan: %d Ino: %d try open(%s) return %i errno %i calling sg_mapdev(...) Warning: Using ATA Packet interface. Warning: The related Linux kernel interface code seems to be unmaintained. Warning: There is absolutely NO DMA, operations thus are slow. errno (EACCESS), you don't have the needed rights for %s try open(%s) return %i, errno %i, trying next cdrom Illegal value for bus, target or lun '%d,%d,%d'try open(%s) return %i, errno %i, cancel INFO: scan_internal(...) failedNOT IMPELEMENTED: scgo_initiator_idioctl(CDROM_SEND_PACKET) ret: %d Generic transport independent SCSISCSI transport for ATAPI over Parallel PortATA Packet specific SCSI transport using sg interfaceBus: %d Target: %d Lun: %d Chan: %d Ino: %d Target (%d,%d,%d): DMA max %d old max: %ld Warning Linux Bus mapping botch. SCSI Bus: %d (mapped from %d) Linux sg driver version: %d.%d.%d Use of ATA is preferred over ATAPI. SCSI unsupported with '/dev/hd*'DMA addr: 0x%8.8lX size: %d - using copy buffer pack_len: %d, reply_len: %d pack_id: %d result: %d sense[0]: %02X Allocated DMA copy buffer, addr: 0x%8.8lX size: %ld host_status: %02X driver_status: %02X No remote SCSI transport available. Can't do %d byte command. ATAPI:1,2,0ATAPI:/ERROR: unknow format INFO: %s -> %s srINFO: l1: 0x%lX l2: 0x%lX ATAPI/dev/cdroms/cdrom*/dev/hd[a-z]INFO: do scgo_open openbydevCannot open '%s'schily - Red Hat%d.%d.%dsgpgATA:scgo_getbuf: %ld bytes Cannot set SG_SET_TIMEOUT. Bus: %d cookie: %X file (%d,%d,%d): %d /dev/hd/dev/scd[0-9]/dev/scd[0-9][0-9]Cannot open '/dev/scd*'PP Bus: %d /dev/pg%dCannot open '/dev/hd*'/dev/pg[0-9]/dev/pg[0-9][0-9]Cannot open '/dev/pg*'ioctl ret: %d None.SCSI open usage error. Supported SCSI transports for this platform:WARNING: device not valid, trying to use default target... scsibus: %d target: %d lun: %d Invalid value for bus, target or lun (%d,%d,%d)Invalid bus or target specifier in '%s'Invalid target or lun specifier in '%s'scg__open(%s) %d,%d,%d HELPhelpscsidev: '%s' devname: '%s' No memory for SCSI structureInvalid lun specifier '%s'Invalid lun specifier in '%s'No Additional SenseRecovered ErrorNot ReadyMedium ErrorHardware ErrorIllegal RequestUnit AttentionData ProtectBlank CheckVendor UniqueCopy AbortedAborted CommandEqualVolume OverflowMiscompareno write currentexcessive write errorsunreachable copy target tracking servo failure focus servo failure spindle servo failure head select fault block not compressible third party device failureread retries exhaustederror too long to correctmultiple read errorsl-ec uncorrectable errorcirc unrecovered errorincomplete block read no gap found miscorrected error de-compression crc errorerror reading isrc numberrecord not foundend-of-data not foundblock sequence errorrecovered data with retriesrecovered data with circrecovered data with l-ecrecovered data with linkingdefect list not availablegrown defect list not found!invalid element address!invalid address for write$cdb decryption error&parameter not supported&parameter value invalid&data decryption error&too many target descriptors& unexpected inexact segment& inline data length exceeded'hardware write protected'associated write protect'persistent write protect'permanent write protect'conditional write protect)power on occurred)scsi bus reset occurred)device internal reset*mode parameters changed*log parameters changed*reservations preempted*reservations released*registrations preempted,too many windows specified,persistent prevent conflict0cleaning failure0medium not formatted1format command failed2defect list update failure8esn - media class event;slew failure;paper jam;failed to sense top-of-form;reposition error; read past end of medium; position past end of medium;medium source element empty;end of medium reached;medium magazine removed;medium magazine inserted;medium magazine locked;medium magazine unlocked>logical unit failure>timeout on logical unit?microcode has been changed?inquiry data has changed?component device attached?device identifier changed?redundancy group deleted?spare created or modified? spare deleted? volume set deleted? volume set deassigned? volume set reassigned?echo buffer overwritten?medium loadablePwrite append position errorSunload tape failureSmedium removal preventedUsystem buffer fullUinsufficient resources[threshold condition met[log counter at maximum[log list codes exhausted\spindles synchronized\spindles not synchronized^Bpower state change to idle^Epower state change to sleepaunable to acquire videoaout of focusdinvalid packet sizegadd logical unit failedgassign failure occurrediparity/data mismatchkredundancy level got betterkredundancy level got worsesprogram memory area is fullsrma/pma is almost fullinvalid sense code 0x%Xvendor unique sense code 0x%X[]no sense, deferred error [No matching qualifier](illegal block length end of medium file mark detected (valid) (not valid) Sense flags: Blk %d %s%s%s%sinvalid sensekeyactual retry count %doperation %d%% done(valid)command(not valid) disk not inserted load/unload failure spindle failure focus failuretracking failurebias magnet failure#illegal function for medium type8recoverable write error9write error recovery failed:defect list update failed=defect list not availablelimited laser lifelaser focus coil over-currentlaser tracking coil over-currenttemperature alarmECC error during verifyinterleave errorbad format on driveself test faileddefective track#volume overflow+set limit violation,error counter overflow-initiator detected error.scsi parity error/adapter parity errorno additional sense informationfilemark detectedend-of-partition/medium detectedsetmark detectedbeginning-of-partition/medium detectedend-of-data detectedi/o process terminatedaudio play operation in progressaudio play operation pausedaudio play operation successfully completedaudio play operation stopped due to errorno current audio status to returnoperation in progresscleaning requestedno index/sector signalno seek completeperipheral device write faultlogical unit not ready, cause not reportablelogical unit does not respond to selectionno reference position foundmultiple peripheral devices selectedlogical unit communication failure track following error error log overflow warning write error error detected by third party temporary initiatorid crc or ecc errorunrecovered read erroraddress mark not found for id fieldaddress mark not found for data fieldrecorded entity not foundrandom positioning errordata synchronization mark errorrecovered data with no error correction appliedrecovered data with error correction applieddefect list errorparameter list length errorsynchronous data transfer errordefect list not foundmiscompare during verify operationrecovered id with ecc correctionpartial defect list transfer invalid command operation code!logical block address out of range"illegal function (use 20 00, 24 00, or 26 00)$invalid field in cdb%logical unit not supported&invalid field in parameter list'write protected(not ready to ready change, medium may have changed)power on, reset, or bus device reset occurred*parameters changed+copy cannot execute since host cannot disconnect,command sequence error-overwrite error on update in place.insufficient time for operation/commands cleared by another initiator0incompatible medium installed1medium format corrupted2no defect spare location available3tape length error4enclosure failure5enclosure services failure6ribbon, ink, or toner failure7rounded parameter8event status notification9saving parameters not supported:medium not present;sequential positioning error=invalid bits in identify message>logical unit has not self-configured yet?target operating conditions have changed@ram failure (should use 40 nn)@diagnostic failure on component nn (80h-ffh)Adata path failure (should use 40 nn)Bpower-on or self-test failure (should use 40 nn)Cmessage errorDinternal target failureEselect or reselect failureFunsuccessful soft resetGscsi parity errorHinitiator detected error message receivedIinvalid message errorJcommand phase errorKdata phase errorLlogical unit failed self-configurationMtagged overlapped commands (nn = queue tag)Noverlapped commands attemptedPwrite append errorQerase failureRcartridge faultSmedia load or eject failedTscsi to host system interface failureUsystem resource failureWunable to recover table-of-contentsXgeneration does not existYupdated block readZoperator request or state change input[log exception\rpl status change]failure prediction threshold exceeded^low power condition on`lamp failureavideo acquisition errorbscan head positioning errorcend of user area encountered on this trackdillegal mode for this trackevoltage faultfautomatic document feeder cover upgconfiguration failurehlogical unit not configuredidata loss on logical unitjinformational, refer to logkstate change has occurredlrebuild failure occurredmrecalculate failure occurredncommand to logical unit failedocopy protection key exchange failure - authentication failurepdecompression exception short algorithm id of nnqdecompression exception long algorithm idrsession fixation errorscd control errorƀ5logical unit is in process of becoming readylogical unit not ready, initializing cmd. requiredlogical unit not ready, manual intervention requiredlogical unit not ready, format in progresslogical unit not ready, rebuild in progresslogical unit not ready, recalculation in progresslogical unit not ready, operation in progresslogical unit not ready, long write in progress logical unit not ready, self-test in progress asymmetric access code 3 (00-232) [proposed] asymmetric access code 1 (00-232) [proposed] asymmetric access code 2 (00-232) [proposed]auxiliary memory code 2 (99-148) [proposed]logical unit communication time-outlogical unit communication parity errorlogical unit communication crc error (ultra-dma/32) warning - specified temperature exceeded warning - enclosure degraded write error - recovered with auto reallocation write error - auto reallocation failed write error - recommend reassignment compression check miscompare error data expansion occurred during compression write error - recovery needed write error - recovery failed write error - loss of streaming write error - padding blocks added auxiliary memory code 4 (99-148) [proposed] copy target device not reachable incorrect copy target device type copy target device data underrun copy target device data overrununrecovered read error - auto reallocate faileddata re-synchronization error unrecovered read error - recommend reassignment unrecovered read error - recommend rewrite the datacannot decompress using declared algorithmerror reading upc/ean numberread error - loss of streamingauxiliary memory code 3 (99-148) [proposed]filemark or setmark not foundrecord not found - recommend reassignmentrecord not found - data auto-reallocatedmechanical positioning errorpositioning error detected by read of mediumdata sync error - data rewrittendata sync error - recommend rewritedata sync error - data auto-reallocateddata sync error - recommend reassignmentrecovered data with positive head offsetrecovered data with negative head offsetrecovered data with retries and/or circ appliedrecovered data using previous sector idrecovered data without ecc - data auto-reallocatedrecovered data without ecc - recommend reassignmentrecovered data without ecc - recommend rewrite recovered data without ecc - data rewrittenrecovered data with error corr. & retries appliedrecovered data - data auto-reallocatedrecovered data - recommend reassignmentrecovered data - recommend rewriterecovered data with ecc - data rewrittendefect list error in primary listdefect list error in grown listprimary defect list not found access controls code 1 (99-314) [proposed] access controls code 2 (99-314) [proposed] access controls code 3 (99-314) [proposed] read type operation while in write capable state write type operation while in read capable state illegal command while in explicit address model illegal command while in implicit address model access controls code 5 (99-245) [proposed] access controls code 6 (99-245) [proposed] access controls code 7 (99-245) [proposed] access controls code 8 (99-245) [proposed]$invalid cdb field while in explicit block address model$invalid cdb field while in implicit block address model&threshold parameters not supported&invalid release of persistent reservation&unsupported target descriptor type code&too many segment descriptors& unsupported segment descriptor type code& invalid operation for copy source or destination& copy segment granularity violation'logical unit software write protected(import or export element accessed)bus device reset function occurred)transceiver mode changed to single-ended)transceiver mode changed to lvd*asymmetric access code 6 (00-232) [proposed]*asymmetric access code 7 (00-232) [proposed],invalid combination of windows specified,current program area is not empty,current program area is empty,illegal power condition request0cannot read medium - unknown format0cannot read medium - incompatible format0cleaning cartridge installed0cannot write medium - unknown format0cannot write medium - incompatible format0cannot format medium - incompatible medium0cannot write - application code mismatch0 current session not fixated for append1zoned formatting failed due to spare linking5unsupported enclosure function5enclosure services unavailable5enclosure services transfer failure5enclosure services transfer refused8esn - power management class event8esn - device busy class event:medium not present - tray closed:medium not present - tray open:medium not present - loadable:medium not present - medium auxiliary memory accessible;tape position error at beginning-of-medium;tape position error at end-of-medium;tape or electronic vertical forms unit not ready;failed to sense bottom-of-form; read past beginning of medium; position past beginning of medium; medium destination element full;medium magazine not accessible;mechanical positioning or changer error>logical unit failed self-test>logical unit unable to update self-test log?changed operating definition?redundancy group created or modified? volume set created or modified?reported luns data has changed?medium auxiliary memory accessibleGdata phase crc error detectedGscsi parity error detected during st data phaseGinformation unit crc error detectedGasynchronous information protection error detectedPposition error related to timingQerase failure - incomplete erase operation detectedUinsufficient reservation resourcesUinsufficient registration resourcesUaccess controls code 4 (99-314) [proposed]Uauxiliary memory code 1 (99-148) [proposed]Zoperator medium removal requestZoperator selected write protectZoperator selected write permit]media failure prediction threshold exceeded]logical unit failure prediction threshold exceeded]spare area exhaustion prediction threshold exceeded]hardware impending failure general hard drive failure]hardware impending failure drive error rate too high]hardware impending failure data error rate too high]hardware impending failure seek error rate too high]hardware impending failure too many block reassigns]hardware impending failure access times too high]hardware impending failure start unit times too high]hardware impending failure channel parametrics]hardware impending failure controller detected]hardware impending failure throughput performance]hardware impending failure seek time performance]hardware impending failure spin-up retry count]hardware impending failure drive calibration retry count] controller impending failure general hard drive failure]!controller impending failure drive error rate too high]"controller impending failure data error rate too high]#controller impending failure seek error rate too high]$controller impending failure too many block reassigns]%controller impending failure access times too high]&controller impending failure start unit times too high]'controller impending failure channel parametrics](controller impending failure controller detected])controller impending failure throughput performance]*controller impending failure seek time performance]+controller impending failure spin-up retry count],controller impending failure drive calibration retry count]0data channel impending failure general hard drive failure]1data channel impending failure drive error rate too high]2data channel impending failure data error rate too high]3data channel impending failure seek error rate too high]4data channel impending failure too many block reassigns]5data channel impending failure access times too high]6data channel impending failure start unit times too high]7data channel impending failure channel parametrics]8data channel impending failure controller detected]9data channel impending failure throughput performance]:data channel impending failure seek time performance];data channel impending failure spin-up retry count]If66 C6HSdS H`HHHI@(#)scsi-linux-ata.c 1.7 04/06/12 Copyright 2002 J. Schillingschilyscsi-linux-ata.c-1.7@(#)scsi-linux-sg.c 1.83 04/05/20 Copyright 1997 J. Schillingscsi-linux-sg.c-1.83-RH@(#)scsi-linux-pg.c 1.43 04/01/15 Copyright 1997 J. Schillingscsi-linux-pg.c-1.43@(#)scsihack.c 1.43 03/11/28 Copyright 1997,2000,2001 J. Schillingscsihack.c-1.43$4CP\jw4H^p#?Tt%;To 5Lh,DYr P     T     H x $L   q54 `     0 I`     b@d&4;lVDlr0\$P|4l<h+& ?`0BPH|@,`zTp<h4Rm8$\T9Rkl4`,<dLhHl7$F(Lp\$Q`lX| %@Y|t4T0L\qLt<\H`v -?\L 1t     !D!!Jd}1Hh!!!"@"x""" #T####($\$$$%D%|%%%$&`&&&'8'l'''$(`((()L)))),*d***+D+x+++,@,p,,,-<-t---.T.... /T////,0d000 1@1x1112H2|22p2 343\3333!30,4@4l4Q4F44 5@5d5`555i 6z<06l6667|X77778<8d888file_write_errj #?*&+?bad_file_opbad_file_modebad_file:<<<<:<<<<0123456789abcdef0123456789ABCDEF(Infinity)(NaN)isodebug.debug5@.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.gnu_debuglink 44HH !hh' / 7oVV Do  @S LL \ ll  e`k  (q44=wPP=T??\P$P$,P,0P0PPL`R`8 _ ELF 4h4 (444444``x``HHH Ptd||S|S$$Qtd/lib/ld-linux.so.2GNUC`T%R_E 9VH>'Y8I;,()] 1^K#P A*W[FSMZXGC<Q. " -3/2$B=@07+:4LONJ?U!D&6\5<<+| #wog`?|Y'q jZo6%;6W.'-6&(<z PooX 9#HG3kw>X*^Xv]BNQ}:RhQ'$+ 0~:b|'x=@VB<CwoJS3`# hc:Z z 91=|gQE 60_Jv_RegisterClasses__gmon_start__libc.so.6putcharstrcpyrcmdioctlsysconfstdoutstrerrorfdopengeteuidgetenv__strtol_internalusleepgetpagesizefgetsmemcpyglobperrorreadlinkputsdup2getuidmallocfflushabort__lxstatstrrchrisinffprintfkillstrcatsetsockoptstdinwaitferrorstrstrrandsignalreadstrncmpstrncpyrealloc_IO_getcstrtokforkstrncatexeclpgettimeofdaymemsetfcvttcgetattrseteuidgetpwuidgetpwnamgetservbynamefclosescanfstderrisnanvallocfputcecvt__ctype_b_locglobfreesocketpairfwrite__xstatrewind__errno_location__fxstatsetbufgcvtfopenfilenogetline_IO_stdin_used_exit__libc_start_mainlseek64strchrfcntlsetuidfseeko64tcsetattrfopen64GLIBC_2.3GLIBC_2.1GLIBC_2.0$ii ii ii `^o o!oK`````aaa a a a a a a$a(a,a0a4a8a$D$RA~% c$t1fDŽ)+\$$ UƅB)ƒ D$D$@sËዽ֋ˉ΋ $ $ TE19h\[^_]$[$t ~"u1fDŽ)/V)Ѝt2-1߹уDŽ kafkfD a$ 1߹уDŽ /mntD $ tPJ1fDŽ)/*1уfDŽ ..D 1fDŽ).F$D$FD$~$, D$ L$$>D$p7 $D$MyRAvyR]$JD$ <$*,L$$ND$yAD$ $TD$‰D$\[1^_]$]UWVSÃd{D$D$`sҡ`{? ;$p $ yo1$PE$ @s `{d{!ȉ $D$ !ڡ@sT$|$ \$D$T$ *|$ $tT$D$o$[^_]$\K !L!)¨u$$ `sǁ./EE`s{`s.$kD$CD$$pC'$wD$C $|D$CD$$C~ui$K tX1tD3!$K 9Ѹ1)Ѓ$ K )9C!.<vu$@sU `{VSd{#`{`sЃ `{!!ډd{ t [^]1.[^]USÃD$$D$N$$$$$$,$NUWVSlDžDž]u DžDžt$$,D$D$D$D$D$ D$T$<$ 9LuzD$<$T$wmtWtED$$o>uO$3>y<$D$$9o.t`{d{D$D$$ih 1\ @sC`D$o$@sËˉΣ`{d{Spop% pD$c$D$$5d{D$T$$de 1҃<[^_]UWVS u}^@D$D$l$jE {CTCC CVCU$ЈCUCXFD4$ڐ [^_]UWVS }uE _@D$t$$D$D$l$E sCTCC CWCU$ЈCUCXGD<$Hx G(u 1҃ [^_]É<$~$)ƋE t$D$躈UVSu^@D$D$l$-CCT%CC CVCUC[$C\ЈCUFD4$蓏xJAYQ A A AY A  ‰1҃[^]UVS ]u J}Eɴ 5fE m\$mm\$ mm\$m4$D$D$@4$D$D$ [^]UVSu^@D$D$l$CTCC CVCU$ЈCU} C\CWFD4$"[^]UVSu^@D$D$l$<CTCC CVCU$ЈCUE $CXFD4$谍[^]UWVSEu] EE~@ED$D$l<$GTGG GFWU1ۋ]tGXMtWUFD4u[^_]UWVS u}^@D$D$l$1E {CTC_C^CC CFDD$RD4$袌 [^_]UWVS }u _@D$D$l$CC CCTGSU…xICVCWuxDECXECYE$ˆSUGDe<$ [^_]CVCWuyCXCYE$ˆSUGDe<$Nj [^_]UWVS u} ^@D$D$l$CT CCC CCUV$ЈCUCVFDru [^_]@UWVS }u_@D$D$l$`E EC CT CC CW$‰SUCVCWECXGDy<$辊x <$|yU)ƒ [^_]UWVS }u_@D$D$l$E EC CT*CC CCUW$ЈCUCVCWCXCYEC[EC\GD<$x <$xU)ƒ [^_]UVSEu] =MU[^]UME] u[^] UWVS Eu}X@D$D$l$E ECTCC EC CPCU$ЈCUCVCWCXCYCZC[C\C]E@D$xE$wU)ƒ [^_]UWVS u} ^@D$D$l$CT CC CV$‰SUCVCWFDu [^_]]UWVS }u _@D$D$l$}CT+CC CWCU$ЈCUCVCWCXCYGD} [^_]ևUE U=]E U]WUVSu^@D$D$l$CT5CC CCxSUF‹E tSUFD4$C[^]UWVSE} uEEEEX@D$D$l$GECT$UEąu6L[^_]$4$BxE$7#$VUWVS }u_@D$D$l$E sCTZCC CWCU$ЈCUUE?‰SVC[C\GD<$xx G(u 1҃ [^_]É<$g$)ƋE t$D$dqUWVS,] =Dpu9tF$4$un$Dp,[^_]ÍD$D$ ?D$D$4$!UWVS }u_@D$D$l$]E sCTCC CWCU$ЈCUUE?‰SVCXGD<$wx G(u 1҃ [^_]É<$ff$)ƋE t$D$-pUWVS<]} C=D$D$4$E\$t$D$ED$ E$xbE$e])Ãf …uYGGfGE@(u1ҁ<[^_]Ã_\$|$$-'oӃ/~뗍CD$GD$$X,mU=DpVSu] MUEt[^]EUM] u[^]UWVSE u}EE^@EEED$D$l$ E{CTUCC CKUFEu }ҀȀ$ЈCUC[C\N(t8UIuND$$S|$E$WD$mFDgu[^_] uUWVS<}u G=ƅƅFFƅƅFƅE@(u6E\$D$ED$ D$E$j<[^_]É|$t$$l봍GD$D$F$EUWVSE u}EE^@EEED$D$l$,E{CTCC CKUFEu }ҀȀ$ЈCUCXN(t8UIuND$$S|$E$WD$kFDvu[^_]5sU=DpVSu] MUEt[^]EUM] u[^]UWVS,u}D$D$$D$D$D$ D$\$4$VxQf ¸҃~"t Et U1,[^_]ËV$tD$$UWVS<(}D$D$$<D$D$D$ D$\$<$f$ X\$JD$D$\$ D$t$<$xZD$$$\$t$x1<([^_]Ëw$t_(~D$$̋O$uD$UWVS,]uD$D$<$E D$D$D$ D$|$$Uf ¸҃ 1Et0   ‹EEtUMtU$tXC$E D$D$D$ D$|$$FFk$U 1td} tfD$D$<$C$UD$D$ |$$D$jU k$1,[^_]ËE U D$D$D$ T$|$$x<t$   ‰$4FFE D$ |$D$$*xCU 6C$~ +D$$ E k$UWVS< D$D$ $VD$T$D$D$ D$E$5f ҃ND$D$D$D$T$ U$ Ex(9 98uuEp(] GD$ GD$GD$G$2MɉtUEP(E MG $1G $1G$1D$ t$\$$ 2UËB(EtE1ҁ< [^_]Á< [^_]û $Z)‰Ћ9T$$T$d9.|$D$ $  dd9rlG$0G$0G$0D$ t$\$E$3Z)QD$ G D$G D$G\$$D$ |$$c \$$$@UWVS,uD$D$<$D$D$D$ D$|$4$SF(f ҍZD$D$\$ D$|$4$x@F(unE t0   ‹E 1ҁ,[^_]É4$X)‰|$$3T$jb44$}X|$)$3\$GboD$?$ UWVS,u} D$D$$D$D$D$ D$\$4$zf ҍB=oD$D$D$ D$\$4$$x1t+DT D  ‰1ҁ,[^_]D$?$UWVS<Džu} F$4$4n$D$D$$dF$D$ ?D$ \$4$D$D$D$$ F D$ ?D$\$4$D$UxV$V<"9s"$^?D$C\9r$ ~n$<[^_]ËF   D$D$$D$ D$ \$4$D$in$b$dD$1$s  ‰T$$  ‰T$UWV}S\u] 4$<$D$D$,*؈]EEE‹@|$4$$D$ D$ <D$`\[^_]UE]$,<UE]@<UWVSE u}EE^@E싆P$D$D$l`E@CC ECCT(CCUV$ЈCUCVCWCXCYEC[EC\FDu[^_]dD$$MUWVSE u}EE^@E싆H$D$D$l~E@CC ECCTCV$‰SUCVCWECXFDu[^_]cD$$eUWVS]M}u 1t DptM]u }[^_] [^_]UVSEu t$ D$D$$趶\$4$`CD$4$$D$;C$D$4$D$C$<wh{w{tLCD$4$D$CD$D$4$C D$D$4$[^]À{u{ t뤉t$ D$D$$8޵C@^C)@ t&ueu;ut$$ 足t$ D$ D$$Jaɉt$ D$D$$U?C량t$ D$D$$]Crt$ D$D$$eCAt$ D$D$$kǴCt$ D$D$$s螴Ct$ D$D$${uCt$ D$D$$L}t$ D$D$$'CLUS]$:C<=yl t&X Y'&>$E[]霰==='=t&A=t&>$y=[ &de&>$)=;='t&-c=0=:t&>us$$===t&>u3$A  D$$<E[] =Xe=Dv=Et&u$) == =u$<$L$X==J$f=3${=&$=$q=Y=$O$C$7$+$$$ ${$,$4$H$W$n$$$$${$o$c$W$K$?$3$"'$4$CUVS]C$s@$k$1҅x [^]Ã~ F+$4$ԣ9+ D$B4$輣9 D$I4$褣9( E@<UD$R${M9$<>UDžDžDžDžDžDžB<D$$D$D$D$ D$D$_t MA<t E@<t UB<t MA<t E@<Eu h$|U0 J<o$D$$ )MAu MA<:ED$8$u6< <  ШuD$ $@~G`.^< <  ШuD$ $}.^< <  ШuD$ $}.S^< <  ШuD$ $X} "u C"uCu.U DM$yj} $.EDžTDžP$}$D$tD$$ԉV$|D$ D$ D$$N~D$$qD$ ${D$ ${D$ ${u$5t$cD$ $6{.D$ D$ D$$5}$D$,SD$$B:UWV1S1҃t<[^_]À?uEU<[^_]ÍE<$D$DŽtڀp€P Шt.E1EU*€x Шu$t딀t€T ШtSE1뾃9EȋEUeȉU܋UE؋]܋EUE̋MÉM]܋]܉]5g€G ШtEUSm€M ШtEU/f€F Шt0 iM0 eUs€S ШtEU k€K ШtEU b€B ШtEU w€W ШEUqUVSU EEËE ։ؙ1؉1 u E [^]É\$t$ D$$薅EE [^]UEUEyM QEUb]U(E D$D$$D$?D$WD$ qD$yD$x1Ut3@ ~,D$l$xuË btU1]UWV1SEUE} EEPh~59~\$ދED$$誓UBh)9}&)D$ED$E$~~9|ڃ[^_]ËUE[^_]UWV1S,}2)=}Í\$$ 9|ʁ,[^_]UWVSUEƉEE E9u5_hx2P> tN9uwɋU[^_]AEt+F ~ED$$D$kYČ[^_]ÍUD$P$FED$P$rUD$ D$ D$$v~+VtugE1D$$*E$F ~(UED$T$D$ UE$D$蟁zuU)=~-E눉c0UWVSEEEE E1}эYu\$E4$D${9t EEEE[^_]UWVSl}Wht8E uD$ D$D$P4$諏ډt$$Al[^_]UMQhtD$$ UMQhtD$$UWVS,E] uHh1ɋ} u'1 u1 u~,[^_]Ë.x㋁tى\$ |$t$D$D$D$$膎E\$$U1WVS}] Ohڅ u~ 1[^_]Ë1\$ H$D$D$D$\$$[^_]US]Clu$ChCltx u[]É$=u҉D$$ >[]U1WVS}Wh2E ]D$ D$D$P$N\$$EPWh]9E|r9]E E $uGlČ[^_]D$\$ D$D$4$+rE-E=‹Wh9.wO ~D$D$$|}WhEGD$\$ D$D$4$qyfE-E=ƋWh9. W .D$D$,$|<$Č1[^_]ËE맋E%UWVSl}Wht8E uD$ D$9D$P4$艋ډt$$?l[^_]UWVS }Wht4u}u\2x u 1 [^_]ÉD$$FËGhǀ4$ oGh [^_]É$`rWhǂ덉$IrWhǂi$/rWhǂEUWVS]|EE$D$LD$ D$P\E\$$QƉ$no1tEt$$؃|[^_]U1VSuM ^ht t v 1[^]$tAta΋t6뼸c뵸Fc뮸Mc막$^h릉$^h뱉$^hUSd]$D$P$D$ D$ D$)od[]UWVS|}Wh_@G,CDžD$DžCD$C D$CD$CD$YD$@D$ $興ƋC D$D$CT$轈s CHGmt$D$$s9t +~3D$D$$s;t $jƅC)CaC QC$AC(1 CLCL~-D$C+$$F1C>tt$$~1|[^_]ËC.=@D$D$$#Dž^1C 됃 CL "UWVSDžUEr,@z Zƒ Шd[u^hM ru D$:E $iE pE hu D$D$t$ $ʅD$:$i|t |D$$ iHp߅D$@$Qi)=v\$D$ D$yD$$~/tE@ ~-|$LptT$ D$$D$v$1ip`$~iPmuLpۉl0]4$k)D$D$D$ $lhZ$VhD$$jtD$$wj$!u$khuFtu!Ĭ[^_]$YuL\$|$D$D$T$ $腃볋UBttD$D$$a$h‰Fh1.xBǂǂǂǂǂǂǂ$f$kׅnUBh8B b|oD$ D$D$P$\$$ExgE hEEËE\$D$ ht$E$_UBhDžǀĬ[^_]D$$kfHpyh$fLp3D$$r$rLptIDžpt$D$$\rxDžl[D$ $lrB$"egW9t$Nigii9tG$Jedp$v[hD$pD$LptT$ D$Hp@D$$guFtsD$@wD$$%t$Kq%GD$$;D$+qD$$CdD$$/dD$$dlD$/$ftXD$pt$tD$ RD$\$D$l$elt$$UwpQ$h@UUM tM UH]ct~`ct1]øcUWVSE@dE ]@dtu rt=U $T$UR xCD$ C D$C$D$a\[^_].tE볋EUE]JUVS] u\$4$P9É ШtˉNT^X[^]UVS] u~\$4$9} 1[^]Ë\$4$PFp[^]US]$PCp[]UE]J UE]J(UE]J,UE]J0UU EPd]US$]E$D$@|hD$ $etaD$$t $[]D$$uD$$߄uD$$˄1҅t$7dUEP@B uJ$uz(u1z+t]UE]@@@UE@@Px@])Ë@]UWVSE[EuX@C(D$t$D$ E $H|xe} )ǀ{(xi{)C(vLC(f%f=ET$ D$D$t$<${x+U [^_]$ C)D$t$D$ <${.x)ƀ{)pC*D$t$D$ <${.x)DE[?5 +!&; KUWVSE] uD$ D$\$E$zxV}(UD$ UD$^\$<$zx3)ÃyD$Z\$<$zx+U[^_]Ã[^_]UED$dD$ED$ E D$E$3UWVSE}u X@C~Ct +E [^_]ÉD$CD$|$D$ 4$z….xҋu C)փd~dD$D$q|$D$ 4$….xUE@@P TD$~D$ ET$D$E $kɉ!UWVS|EEux@G t:t*]D$ D$D$@$yڋMADt8tEEM T$D$D$ t$L$G$$Sx9] )ËEt$\$$x)ƃ G(u+U |[^_]ËGLt$$D$ G+ED$.x)ƍG(D$MED$L$ t$\$$W.x땅GMbD$EH`Y؍])‰T$D$D$@D$ $wMt$\$ $J.)U1҉WVS,}]G(~oG@@D$GD$G D$GD$GDD$ \$D$ E $awx,u )É<$Ɖ\$t$x)Ã(+U ,[^_]É\$t$<$.xƉ+U US]K|+St$L$)ЉD$&C|[]UWVSEu X@$NjC~Cu +E [^_]ÉD$C|$|$ D$ED$PD$4$sv….xNju )Uփd~dD$D$4$D$ ED$….xUMbWVS}uG@@D$O`Y)‰T$D$t$D$ E $ux] )Ã(+U [^_]Ét$\$<$.xUWVS}]<$M tE 0t2G$~W(t'E<$D$ED$xq])EËG$~G(t7G@xt+|g@D$$D$ ED$ux,)EG(~*E\$<$D$xÉ+U[^_]ÅyG$ɋED$$D$t.x)EG@nUWVS]Es${(C$C(D$ E $D$D$s${([^_]UVSEu D$\$$~D$\$4$\4$oX[^]UU$D$US]K|+St$L$)ЉD$ ED$ C|E[]US]$][]UVS]D$t$$~$D$t$$[$W[^]UWVS }u]E D$D$D$^D$<$DryE Z} [^_])rUED$ E D$ED$o$UVS EX@$ƋC~Cu [^]ÉD$Ct$ t$D$oD$P$qd~dD$$D$` [^]UMbVS ]C@@D$K`q)‰T$ D$D$o$5q{( [^]]$ [^]\USEX@C~Ct[]ÉD$ CD$D$o$pCd~dD$$qD$[]UE@@P T$~T$D$YUWVS }E u]D$D$<$Wpx'B^w/T$D$<$0pyE Z} [^_]pD$<$pUED$ E D$ED$o$[UWVSE] uD$ D$\$E$MpxX}T$ D$\$<$*px5)Ãx8EEB^vD$\$<$oyˉƒ[^_]D$Z\$<$o.xۍ+U[^_]UED$dD$ E D$E$qUE D$ED$o$UE]@@@(UVSEX@$n1҅tC+$F$.LF >1e>F$uF #F UEU tdt~dt1]øeU(E D$D$$D$D$bD$ D$lD$)1K1UWVSEPhEEEB EE}Ph17DZx$JEPhfDZ~׃E}~ȃEm老}~>t"$UBtFČ[^_]ËExhou tgu t$U :}1}ED$D$D$ $mEE 놐t&<ttt Ex v{<Ƌ >u\$D$(U$VD$|$ \$D$dU$Vo<$P;b$ OtU D$D$T$ $U1Uz >~"D$|$ \$D$$TU$;UBtD$$TvU]U1VSU w5EXh1t)11ҍf|Cy~~1[^][^]U1VSM ]u u71 u&!EPhtDB[^][^]UD$E@t$4SUEP@hP $t1҅‰]U1U tBwE SU];]UWVSuF^@x{ ~C C$1ҁČ[^_]ÍExD$D$,$eED$D$@<$MECCDECtEC 1҅~DTD9S CEȋEċC@ƅ8iCD$S}ЉE܍ED$F$: Ct43M9t+EȋS9vЉD$L$4$9EȋS9v)ЉCC xC(CE$EtCLxC+|C/EC3EC7EC;EC?ECCEC(CGE@tuC C( u,C$tb.+ƒ  к. PC$~ |$D$<$PUЀ:uztC$UWVSU] t3rht0Rx9t%t~A ett;1[^_]Ãd.t~eu߃[^_]øe^e䋶 .xQ)ڍRȹhЉ)‰T$ )ډi'U)É؉)L$ED$D$D$ $PpyPPp9US$] D$D$$D$D$bD$ [D$`D$5$D$D$D$D$bD$ [D$D$4E\$$=$D$D$D$D$bD$ D$D$)w4$[1]UWVSÃLUUu}xDЋM)‹E UttL[^_]ÍEMD$SD$ $61҅u֋C ~$ED$RD$ ED$$CNED$SD$E$k6ẺUԉMЉE؁{ U~0D$EԉT$D$ EL$D$D$$MEUM EԋUЉMtE܉.U؉EgUWVSEPhEEE9tLfDŽBE}17DZx$1EPhfDZ~׃E}~ȃEm䀁}~>t"$5EPhǂǂtXxNfDŽBE17DZx$Q1EPhfDZ~׃E}~1[^_]USÃD$$3$D$D$3[]UWVS<}Gh NBE EEEE1kUt$ T$U<$T$P$.x׍EED$r"D$$3.xE9E~ED$u"D$$3~E}{E}cE ;EEEE1kUt$ T$U<$T$P$.x׍EED$r"D$$23.xE9E~ED$u"D$$ 3~E}{E}cEE1Ut$ T$U<$T$P$xcED$r"$D$2xH_ ~6EUt$D$ET$ D$ED$D$$JE;E}EqE}aE}I]Gh>yt6xW;t x ؃<[^_]ËU 9|U t&UWVS u} F ~|$D$$\Iy/Í8$21tFhVlډЃ [^_]US]Clu Cl[]É$61Cl[]U1VSU w5EXh1t)11ҍf|Cy~~1[^][^]U1VSM ]u u71 u&!EPhtDB[^][^]U]US]Sh9CtAu3ED$"ED$C$-0x 1Ƀ}[]UWVSLE] PhpE9PtBE}D$"|$4$/x1҅ttstKL[^_]ÍU1ׅEPEZttL,ƒL[^_]E|$D$"4$S/1҅yEt&׉T$D$4$+USÃU$,‰U҉Ut ЉEED$"$D$.x[]$8[]UWVSP4|$D$$,x%=`D$<$-D$D$<$f-XD$D$$$1V8Dž\$ CXD$<$D$.t!8+ vtt  tD$<$D$,[^_]UWVSLUE@h GxG xwxEEU؉D$ED$ED$ ED$ED$E܉$Mu MMw~Whrf f9tD$D$[6u܉؃E>u~_ ƉE܅~rEt$D$hD$ $nDu܁vN1L[^_]1ҋ_h9t%SfufSЃE.twU.xEE.xMȋ_hЍf|CEYMԅ-;uMȍfDCE؉$i(?frmǀ ED$"D$$+.*Ghu G,QD$)ڍRȹhЉ)‰T$ )ډi'U)øQ؉)L$ MЉ$L$B;U  E;EU؉=GhU؉G1{U؉Gh'U؉MfLCUWVSDžPDžLUBJ Z=X\ƒ` Шu~+'MQtn[^_]ËE tUE tKgqÃAuU BTu BAuBuDžLE MAhL`} tM 9uwX1\u]L1P1ۅ1P~ UBttPP~ UBttE M 91DžT} M D$ $'=7TډD$`D$D$\D$ D$X$El`UD$ \$D$XD$`D$\TD$Xډ$EL$ rEDžDpPx Hƒ Шu H">%MAt>t*H|$t$ T$D$D$$@PEX DžTDž<UT1ۋBhHL$D$D$ $?<1EPh7DBft0Tt$D$\$ T$D$(M$>~~TtM D$D$L$ $>13=u `U BaTGDžT8MD$D$L$ $E#"ED$D$$D$ $S"E1..D$4$U%x{`ډD$\D$ D$X$E.\Xy`PE.4tUBt>tD$fD$$=l".t.ttMAt>tt$ D$D$$@=E$#WEHh1f fAyUB ~&D$~D$$6<EHh>y ǁE t U :1 _HQ19`U|$ D$$D$ N<MD$ $l#EHPh>f\B$ 2!1ۉEɉHh.O1Lǁǁǁǁ fǁfǁǁDžT1T1fDŽQ12fDA~~ჅTT~`D$D$D$\$D$XD$ ;WUB,>tD$$9:ME dD$ $dED$D$D$ $HE1D$4$!dD$"$D$!7FڃaD$ `D$\D$X$Em\Xy`PEt 4OM $c UBt>tD$D$$9$뮋UBt>tD$D$$m9Y.z.p.f ])hDžHD$D$ D$$hD$T$ D$$$lDž@tƍFD$ D$ D$$D$4$SEDPhf\Bl@t @4uh $D~ UBtt} hM 9\H1.D$ $ 1} U Dx1 MAhHf\PL$ |$D$E$DDTUMBtu1@UBttM L$ D$D$$$7΋MAt>tD$D$$6..UBt>tt$ D$D$$6h $EKDU$fUWVS4Dž@4Džr@0~ 4Yh9AV4;P4t04Zh;,(4@ ~)FD$ D$D$4$5V~l4YhtV,(;~4_ [^_]ÉЃ$)(V$,_$FDž $$$$ D$D$$,$&,$  Q4AhQ,H61D2T,D $9|Fu),T8$9tFT$D$$4~_$\$,T$0 $V9t!\$ D$4BD$D$X%4Ah9,@ D$T$0 $lOFt",$;tFD$$D$4,B F F$z pFF)$F,x4B(~FB ~?,AD$A D$AD$AD$ D$,D$$24P49Vt 01[^_]Í$F,xbF+N(FLD$D$,$3V$,F$ F F$yHAX<$4X ‹@XD$ BhD$pD$$14Yhw.F(8D$D$l$#F+8FDž@<DžHDžDƅVU$ЉڈF4x F+TFLTD$$(D$,$1(,NDž 4$|~!4A`9|Mt@F H4B`uF(F$F "4Xh9H}F$F 4P40UWVSlEE]Cs@xChf~'l[^_]F F$1l[^_]Í}D$D$@<$!ESF>EF EFEFEEFTEF+EiFMEĉ|$D$"C$8NjC ~|$D$$.iEԈF(E׉FLK ~&EډD$ ED$D$$.E؃vFE E$eC`U9}LF$F F tF$uF$E܉F1E1~EF 볉$~~C`uF(F 독ZEtV$uF$~+i~(_FLuFL~-~7u{~8uuF(F+FL'?,F$ƒ Шt ChfxCN$ƒ Шu RxxF(fǀGUEU tdt~et1]ø#fU$i1U1]UD$${UD$$ZUU1U1U]U1]U]U]U1]UxU`ÐUU EP4]US]C\uEC`uMC@uUu]ueChum$0Ctuu][]$C`t$uC@t$ft$Tt$BCht$3$軭Ctt$][]US$1҅D$D$$cD$ D$D$$CC4CL$1C\$C`tp$lC@t]$CttJCxC|o$$t $څt[]É$1[]US]$$1[]UVSut5@d$7t$$P趕t$$P$1[^]UWVS\DžDžE DžDžDžtE UP EC,Eƅt U:9t5oD$@$(D$ D$D$$M1}U~4CD$C D$CT$D$D$ o$($D$赩څ\[^_]É49uqruVD$:$  u7+u~t$U$T$Ƅ5G<@D$,$ W.1DžDžDžDžDžDž1:c 1ҁ\[^_]ËUoD$>T$$"&uRCD$C D$ CD$|D$o$%D$ D$D$TD$MD$o$%덋BDžDžDžD$D$D$ D$E$D$ UEB<(<: ШtSD$:E$ t6D$:$f . Uƅ D$U$T$ EDžDžD$,$@E .D$\UT$E $$1E t Ct$R1<,iD$4$S8E\ E .kt$ D$yED$U $;$1H} t8D$D$D$D$ UT$E $#$D$8,E .tыD$D$ UT$E $#B瀽DžDžD$E$D$ ED$ D$UT$E $"A9. $D$0,„ Шt8t1G $D$]8u-(} .sD$D$ u .PD$D$ zUWVS]u }uUCs{ S[^_]ËE|$t$$D$ R$UsC{ S[^_]ÐUWVSME] ɋ}1t9tdug~݃@MpU1u"9\$ D$ ED$<$9![^_]B;EuB[^_]É\$ D$ UT$Ńg.UEwNfAED$LD$ ËED$LD$ 벋ED$MD$ =f.gUWVSEEEEEDž|DžxDžtDžpDžlDžhDždE u $E |$D$E$xσ [^_]UWVSEu} uE t:E)Dž~/t$|$E$}Et[^_]ËE[^_]ËE$UEEED$ED$E $1Ʌt;ED$D$E$o1ɅxET$$D$`ÐUW1VSE] €  Шu+-Uu0E t"A< w30;E}} uދEtߋE 8[^_]ÍAq<< Ш.tω<w7W뤃 qE _E x€X ШSE cU E D$D$E$U ED$E$MU ÐUWVS$EE}E €  Шu+-Uu0E EE؉ULp;u}uE]ue]܉щEЉً]]EЉUEMԋUUt4A< vAY<€ Шtpvp;u|Et ]U]E UMH$[^_]Ã!EEx€X ШEU E D$D$E$mÐU$ ¸tEBE Brr1USr]tB$D$Rr£ru$SUWVS u"$4$l$… 1Ҩu [^_]UWVSÃL!xN4$tbU T$UD$|$T$ $Nu L[^_]É4$L[^_]ËE D$ U|$$NT$Eȉt$ D$ND$$EwUEUD$E $16US]  U\$$1[]UEUD$E $US] U\$$¸[]UE D$ND$ ED$o$ ÐUVSM EUxt y؉ É ÉЉу‰~?yӃ~ [^]È[^]ÐU<,„ кtÉL$$NɉUVS!Au_€- Шu1=[^]UWVS\E] :<-<-<+t{DžDžDžuIUDžE ?-M}tM EPB< Ȩt DžU -\t:$nD$t& +1;tK빃: uv{uF<, ШtыE<+=1tu1;u<&tV,1t7&1}t ,1uɋu;t *H?$N{t&,1t7&1}t ,1uɋEM <VB< ȃEP;.G;u.=~,v0Nl€L Ш$Fu+&1}t ,1uɄtEt u1;}|;}`^y>t߀,„ ШuȀi€I Шul€L ШF;|DŽfDŽYƄw-+!E1.M Dž;-bDž{K\[^_]À~ ;Qvs€S Шt Ffc€C Шt FlVB< ȨD$$.1;.;.8ZuF<+t+BxFWN,„ ШtAi뷀l€L ШtNFt$$v؃[^_]D$ D$D$$atD$$6뭉oD$E $ixu1늋E $x1xUWVSEUB:EEBX~EUJuR$xM4$L$׃yED$E$׋UBtM$ L$׃yE[^_]USӋR ȃ@ouS []USӋR ȃ@ouS []USӋR ȃQouS []UWV}S_ 1҃@oɈu_ [^_]UWVSEEB}EU1FуMV,M~ E+}~}t,~$ t&V(:tED$$V(UV(:uFuF$x؋U$T$UyF,t~$ tsE>E$0D$UmyUtMEL$$UUu^tM$ L$UyE[^_]ËV(:.tML$$V(UV(:uaF9)ȉEvUVSøPt1N؅x&ȋVx t  yF[^]CUWVS DžDžEU uDž%M $L$U<%u׍ƅ1҉DžDž DžDžà w$PĜ [^_]À*DžӃDBЉC< v݀.Dž$P|$U$P|$|$$PƅIt)>$P‰D$~BCwC$P0EEۉM9MɉUtE܉EEEUMHEU0^_É;}vUM̉UMEUEU0^_ǃEua9}w9urŰE)E܉ŰUtE܋ỦEUMEUQ녅u 1ƋẺE܉U= +EԉE؉MMM׊M؋U E̊ME̊M؋E ẺE̊MUe;ỦEw uE9Ev M)MȋEM̋E+EщM̉ʊMMԉE ‹EUEUWVS [ E)19s׉M)F9Ήr [^_ÉUWVS[Ù ) pNu. [^_ÐUSR`` vЋuX[US[3PY[Cannot put tty into normal mode Reserved bit setting in symlinkWarning - mount point requestedIncorrect length in symlink component**BAD RRVERSION (%d) for %c%c Zone, zone offset: %14llx %12.12llx -version Print version info and exit -i filename Filename to read ISO-9660 image from dev=target SCSI target to use as CD/DVD-Recorder If neither -i nor dev= are speficied, is needed. Enter new starting block (in hex):Only one of -i or dev= allowed Cannot put tty into raw mode [%d;%dH%c%cPXPNSLNM=%sCLPLRETF=%xWarning - host_name requested=[%x,%x,%d]=%dFlag %x != %x. %3d [%2d] %5x %8d %02x/.. Usage: %s [options] image Options: -help, -h Print this help help,h,version,i*,dev*rbCannot open '%s' Enter new search string:%llxBad Argument: '%s' ISO-9660 image not specified Stdin must be a tty Bad Option: '%s' linux-gnui6862.01isodump %s (%s-%s-%s) gngIggg#ggggggggggggggggggggggRead error on old image Seek error on old image . %s%sCannot open SCSI driver. Cannot get SCSI I/O buffer. test unit readyrezero unitrequest_senseinquiryInquiry Data :read capacitySectorsize: %ld Bytes medium load/unloadprevent/allow medium removalstart/stop unitset streamingscsi_set_streamingset cd speedqic 02write_g0write_g1write_g5seek_g0seek_g1flush cacheread bufferwrite_bufferread subchannelread tocread headerread disk inforead track inforeserve trackreserve_track_rzoneread dvd structuresend opcclose track/sessionread master cuesend_cue_sheetread buffer capBFree: %ld K BSize: %ld K blank unitscsi_format: preparingformat unitscsi_format: running- [unable to fork()]mode sense g1Mode Sense Datamode sense g0Mode Sense Data (converted)SaveSet %s Mode Parametersmode select g1mode select g0Cannot read TOC header CD-Text len: %d wctbcdtext.datCannot read CD-Text header Cannot read CD-Text Cannot read TOC TOC data: ENT: B0 lout: %ld B0: B0 start: %ld tocheader: Session info too big. Pages: 0x%X Density: 0x%X Blocks: %ld Blocklen:%ld read_g1capacity_not_setread_g0Device type : Version : %d Response Format: %d Vendor_info : '%.8s' Identifikation : '%.16s' Revision : '%.4s' Capabilities : SOFTRESET CMDQUE LINKED SYNC WBUS16 WBUS32 RELADR TERMIOP AENC Device seems to be: Adaptec 4010Kodak PCD-600Sysgen SC4000Matsushita CW-7501Generic mmc2 DVD-R/DVD-RWGeneric mmc CD-ROMMissing Entry for dev %dPioneer DVD-R S101Plasmon RF-4100Emulex MD23Sony CDU-924SGeneric mmc2 DVD-ROMPhilips old CDD-521Ricoh RO-1420CPhilips CDD-2600Sony SMO-C501Adaptec 5500Generic NON CCS DiskAdaptec 4000Adaptec 4070Philips CDD-2000Maxtor RXT800SMatsushita CW-7502unknownBerthold HR-ScannerRicoh RO-1060CAdaptec 4000/4010/4070Generic CCS DiskAdaptec 4520AGeneric mmc CD-RPhilips CDD-521Yamaha CDR-100Emulex MT02Adaptec 4525Emulex MD21Microtek MS300APhilips CDD-522Yamaha CDR-400Pioneer DW-S114XGeneric mmc CD-RWGeneric CD-ROMTeac CD-R50ScaddythisTry to load media by hand. CD capabilitiesInquiry Data : RXT-800SACERCREATIVEGRUNDIGJVCMITSBISHMITSUMIOPTIMAPHILIPSIMSKODAKHPPINNACLEPIONEERPLASMONPLEXTORRICOHSAFSANYOSONYTEACTRAXDATATraxdataT.YUDENWPIYAMAHAMATSHITACDS615EBERTHOLDEMULEXADAPTECCR-4020CCDR2000CDD521/00CDD521/02CDD521CDD522PCD225KHSW/OBCDR-240CDD20CDD26C4324/C4325CD-Writer 6020CDR100IPWXR-W2001XR-W2010R2626CD-R 650ACB-4520ACB-4525RCD-1000RCD5020RCD5040RCD 4X4CD-WO DW-S114XCD-WO DR-R504XDVD-R DVR-S101RF4100CDR4220CD-R PX-R24CSRO1060CCD-R2004CD-R2006 CD-R2006PLUSCD-RW226CD-R4012CD-R CDU92CD-R CDU94CDR4120CD-R55SCD-WO CRD-R24SCD-WO EW-50CDR10CDR200CDR400CDR-632PCD-R CW-7501CD-R CW-7502 %s: %5d kB/s (CD %3ux, DVD %2ux) 32162424 (I2S)traypop-upreserved(3)disc changercartridge changerreserved(6)reserved(7)CLV/PCAVreserved(2) Drive capabilities, per MMC page 2A: read CD-R medianot Does %s%s write CD-R mediaread CD-RW mediawrite CD-RW mediaread DVD-ROM mediaread DVD-R mediawrite DVD-R mediaread DVD-RAM mediawrite DVD-RAM mediasupport test writingread Mode 2 Form 1 blocksread Mode 2 Form 2 blocksread digital audio blocksread multi-session CDsread CD bar coderead R-W subcode informationreturn CD ISRC informationsupport C2 error pointersdeliver composite A/V dataplay audio CDsLoading mechanism type %s: %s Is %s%s support changing side of diskMaximum read speedCurrent read speedMaximum write speedCurrent write speedBuffer size in KB %s: %d Write speed # %d: %s MMC-2send digital data LSB-firstLength of data in BCLKsRotational control selected MMC-3Capacity: %ld Blocks = %ld kBytes = %ld MBytes = %ld prMB scsi_format: post processing %d Formating in progress: 0.00 %% done. Formating in progress: %.2f %% done [%d]. Formating in progress: 100.00 %% done. Mode Parameters (un-converted)Cannot load media with %s drive! error: %d scb.chk: %d sense_count: %d sense.code: 0x%x restart non-streamed digital audio reads accuratelysupport Buffer-Underrun-Free recordingread fixed-packet CD media using Method 2return R-W subcode de-interleaved and error-correctedread raw P-W subcode data from lead inreturn CD media catalog numbersupport ejection of CD via START/STOP commandlock media on power up via prevent jumperallow media to be locked in the drive via PREVENT/ALLOW commandcurrently in a media-locked statehave load-empty-slot-in-changer featuresupport Individual Disk Present feature Number of supported write speeds: %d Number of volume control levelssupport individual volume control setting for each channelsupport independent mute setting for each channelsupport digital output on port 1support digital output on port 2set LRCK high for left-channel datahave valid data on falling edge of clockCopy management revision supported:zD7Mb?<  ATIP start of lead out: %ld (%02d:%02d/%02d) ATIP start of lead in: %ld (%02d:%02d/%02d) Mode Page DataCannot get default %s data. Cannot get %s mask. Cannot get %s data. Cannot get saved %s data. Mode Select DataWarning: controller returns wrong page %X for %s page (%X). Warning: controller creates hard SCSI failure when retrieving %s page. Warning: controller does not support %s page. Warning: controller returns zero sized %s page. Warning: controller returns wrong size for %s page. Warning: using default %s data. /etc/cdrecord.conf,:/@%s=CDR_DEVICECDR_DEVICE=CDR_FIFOSIZEBad fifo size environment. CDR_SPEEDBad speed environment. CDR_SPEED=CDR_FIFOSIZE=Bad fifo size in defaults. Value %lld is too large for data type 'long'. REMOTE:rscsi@host:1,2,0rscsi@host:bus,target,lunREMOTE:Remote SCSIRSCSIProtocol error (got %s). Remote status(%s): %d '%s'. R%d A isatapiI initiator idT%d %d %d %d filenoB%d %d havebusF freebufM%ld getbufsndsize: %d rcvsize: %d D%ld maxdmacloseV%d versionS%d %d %d %d %d sendcmdREMOTE%.*sRSHdup2 failed. Illegal remote device syntaxO%s opentcpshellCannot create socketpair. /opt/schily/sbin/rscsiUnknown user: %s rshshell/tcp: unknown service setuid(%lld) failed. seteuid(%lld) failed. -lexeclp '%s' failed. Lost connection to remote host ?? locuser: '%s' rscsiuser: '%s' host: '%s' Warning: Using remote SCSI interface. Illegal value for busno, target or lun '%d,%d,%d'who are you? No passwd entry found. Cannot get connection to remote hostrcmdsh: fork to lose parent failed. ###W#W#W#W#W#W#W##y#g#yesYESstatus: 0x%x Reserved(%s%s) host adapter detected errorBUSYINTERMEDIATE GOOD STATUSRESERVATION CONFLICTCHECK CONDITIONCONDITION MET/GOOD %02XSense Bytes:Write Data: CDB: retryable errorfatal errorerror: %d%s: scsi sendcmd: %s no errorReceived Data: resid: %d DMA overrun, vendor specific %d unknown device type 0x%xRemovable not present unsupported reserved unsupported TapeWORMProcessorPrinterunit not presentWell known lunAutomation/Drive InterfaceObject based storageBridging expanderOptical card r/wSimple direct accessEnclosure servicesStorage arrayIT8 2IT8 1CommunicationJuke BoxOptical Storageunknown/no deviceSCSI ALREADY RUNNING !!INTERMEDIATE CONDITION MET/GOODSending %d (0x%X) bytes of data. SCSI command name not set by callercmd timeout after %ld.%03ld (%d) s Executing '%s' command on Bus %d Target %d, Lun %d timeout %ds Got %d (0x%X), expecting %d (0x%X) bytes of data. cmd finished after %ld.%03lds timeout %ds Cannot send SCSI cmd via ioctl ret < 0 errno: %d ux_errno: %d error: %d Currently running '%s' command. 101201(20101011010101010101012010101 20101012?? @@??@@@@@@@@v@i@\@O@E@F?F?F?F?F?F?F?F?F?F?F?;@@scgo_send(%s) wrote %d bytes (expected %d). DMA (read) overrun by %d bytes (requested %d bytes). ATA Packet specific SCSI transportEXAMPLE: /dev/scsi/host1/bus2/target3/lun4/cd EXAMPLE: /dev/ide/host0/bus0/target1/lun0/cd EXAMPLE: /dev/hda or /dev/sr0 ERROR: in scgo_get_first_free_shillybus(...). Too many CDROMs, more than %iIncrease MAX_SCHILLY_HOSTS in scsi-linux-ata.c and recompile!ERROR: unknow subsystem (%s) in (%s) ERROR: this cdrom is already mapped %s(%d,%d,%d) INFO: subsystem %s: h %i, b %i, t %i, l %iERROR: with link merging! base %s link %s, result of merging %i ERROR: with link reading! link %s, result of readlink %i INFO: /dev/%s, (host%d/bus%d/target%d/lun%d) will be mapped on the schilly bus No %d (%d,%d,%d) INFO: Bus: %d Target: %d Lun: %d Chan: %d Ino: %d try open(%s) return %i errno %i calling sg_mapdev(...) Warning: Using ATA Packet interface. Warning: The related Linux kernel interface code seems to be unmaintained. Warning: There is absolutely NO DMA, operations thus are slow. errno (EACCESS), you don't have the needed rights for %s try open(%s) return %i, errno %i, trying next cdrom Illegal value for bus, target or lun '%d,%d,%d'try open(%s) return %i, errno %i, cancel INFO: scan_internal(...) failedNOT IMPELEMENTED: scgo_initiator_idioctl(CDROM_SEND_PACKET) ret: %d Generic transport independent SCSISCSI transport for ATAPI over Parallel PortATA Packet specific SCSI transport using sg interfaceBus: %d Target: %d Lun: %d Chan: %d Ino: %d Target (%d,%d,%d): DMA max %d old max: %ld Warning Linux Bus mapping botch. SCSI Bus: %d (mapped from %d) Linux sg driver version: %d.%d.%d Use of ATA is preferred over ATAPI. SCSI unsupported with '/dev/hd*'DMA addr: 0x%8.8lX size: %d - using copy buffer pack_len: %d, reply_len: %d pack_id: %d result: %d sense[0]: %02X Allocated DMA copy buffer, addr: 0x%8.8lX size: %ld host_status: %02X driver_status: %02X No remote SCSI transport available. Can't do %d byte command. ATAPI:1,2,0ATAPI:ERROR: unknow format INFO: %s -> %s srINFO: l1: 0x%lX l2: 0x%lX ATAPI/dev/cdroms/cdrom*/dev/hd[a-z]INFO: do scgo_open openbydevCannot open '%s'schily - Red Hat%d.%d.%dsgpgATA:scgo_getbuf: %ld bytes Cannot set SG_SET_TIMEOUT. Bus: %d cookie: %X file (%d,%d,%d): %d /dev/hd/dev/scd[0-9]/dev/scd[0-9][0-9]Cannot open '/dev/scd*'PP Bus: %d /dev/pg%dCannot open '/dev/hd*'/dev/pg[0-9]/dev/pg[0-9][0-9]Cannot open '/dev/pg*'ioctl ret: %d None.SCSI open usage error. Supported SCSI transports for this platform:WARNING: device not valid, trying to use default target... scsibus: %d target: %d lun: %d Invalid value for bus, target or lun (%d,%d,%d)Invalid bus or target specifier in '%s'Invalid target or lun specifier in '%s'scg__open(%s) %d,%d,%d HELPhelpscsidev: '%s' devname: '%s' No memory for SCSI structureInvalid lun specifier '%s'Invalid lun specifier in '%s'No Additional SenseRecovered ErrorNot ReadyMedium ErrorHardware ErrorIllegal RequestUnit AttentionData ProtectBlank CheckVendor UniqueCopy AbortedAborted CommandEqualVolume OverflowMiscompareno write currentexcessive write errorsunreachable copy target tracking servo failure focus servo failure spindle servo failure head select fault block not compressible third party device failureread retries exhaustederror too long to correctmultiple read errorsl-ec uncorrectable errorcirc unrecovered errorincomplete block read no gap found miscorrected error de-compression crc errorerror reading isrc numberrecord not foundend-of-data not foundblock sequence errorrecovered data with retriesrecovered data with circrecovered data with l-ecrecovered data with linkingdefect list not availablegrown defect list not found!invalid element address!invalid address for write$cdb decryption error&parameter not supported&parameter value invalid&data decryption error&too many target descriptors& unexpected inexact segment& inline data length exceeded'hardware write protected'associated write protect'persistent write protect'permanent write protect'conditional write protect)power on occurred)scsi bus reset occurred)device internal reset*mode parameters changed*log parameters changed*reservations preempted*reservations released*registrations preempted,too many windows specified,persistent prevent conflict0cleaning failure0medium not formatted1format command failed2defect list update failure8esn - media class event;slew failure;paper jam;failed to sense top-of-form;reposition error; read past end of medium; position past end of medium;medium source element empty;end of medium reached;medium magazine removed;medium magazine inserted;medium magazine locked;medium magazine unlocked>logical unit failure>timeout on logical unit?microcode has been changed?inquiry data has changed?component device attached?device identifier changed?redundancy group deleted?spare created or modified? spare deleted? volume set deleted? volume set deassigned? volume set reassigned?echo buffer overwritten?medium loadablePwrite append position errorSunload tape failureSmedium removal preventedUsystem buffer fullUinsufficient resources[threshold condition met[log counter at maximum[log list codes exhausted\spindles synchronized\spindles not synchronized^Bpower state change to idle^Epower state change to sleepaunable to acquire videoaout of focusdinvalid packet sizegadd logical unit failedgassign failure occurrediparity/data mismatchkredundancy level got betterkredundancy level got worsesprogram memory area is fullsrma/pma is almost fullinvalid sense code 0x%Xvendor unique sense code 0x%X[]no sense, deferred error [No matching qualifier](illegal block length end of medium file mark detected (valid) (not valid) Sense flags: Blk %d %s%s%s%sinvalid sensekeyactual retry count %doperation %d%% done(valid)command(not valid) disk not inserted load/unload failure spindle failure focus failuretracking failurebias magnet failure#illegal function for medium type8recoverable write error9write error recovery failed:defect list update failed=defect list not availablelimited laser lifelaser focus coil over-currentlaser tracking coil over-currenttemperature alarmECC error during verifyinterleave errorbad format on driveself test faileddefective track#volume overflow+set limit violation,error counter overflow-initiator detected error.scsi parity error/adapter parity errorno additional sense informationfilemark detectedend-of-partition/medium detectedsetmark detectedbeginning-of-partition/medium detectedend-of-data detectedi/o process terminatedaudio play operation in progressaudio play operation pausedaudio play operation successfully completedaudio play operation stopped due to errorno current audio status to returnoperation in progresscleaning requestedno index/sector signalno seek completeperipheral device write faultlogical unit not ready, cause not reportablelogical unit does not respond to selectionno reference position foundmultiple peripheral devices selectedlogical unit communication failure track following error error log overflow warning write error error detected by third party temporary initiatorid crc or ecc errorunrecovered read erroraddress mark not found for id fieldaddress mark not found for data fieldrecorded entity not foundrandom positioning errordata synchronization mark errorrecovered data with no error correction appliedrecovered data with error correction applieddefect list errorparameter list length errorsynchronous data transfer errordefect list not foundmiscompare during verify operationrecovered id with ecc correctionpartial defect list transfer invalid command operation code!logical block address out of range"illegal function (use 20 00, 24 00, or 26 00)$invalid field in cdb%logical unit not supported&invalid field in parameter list'write protected(not ready to ready change, medium may have changed)power on, reset, or bus device reset occurred*parameters changed+copy cannot execute since host cannot disconnect,command sequence error-overwrite error on update in place.insufficient time for operation/commands cleared by another initiator0incompatible medium installed1medium format corrupted2no defect spare location available3tape length error4enclosure failure5enclosure services failure6ribbon, ink, or toner failure7rounded parameter8event status notification9saving parameters not supported:medium not present;sequential positioning error=invalid bits in identify message>logical unit has not self-configured yet?target operating conditions have changed@ram failure (should use 40 nn)@diagnostic failure on component nn (80h-ffh)Adata path failure (should use 40 nn)Bpower-on or self-test failure (should use 40 nn)Cmessage errorDinternal target failureEselect or reselect failureFunsuccessful soft resetGscsi parity errorHinitiator detected error message receivedIinvalid message errorJcommand phase errorKdata phase errorLlogical unit failed self-configurationMtagged overlapped commands (nn = queue tag)Noverlapped commands attemptedPwrite append errorQerase failureRcartridge faultSmedia load or eject failedTscsi to host system interface failureUsystem resource failureWunable to recover table-of-contentsXgeneration does not existYupdated block readZoperator request or state change input[log exception\rpl status change]failure prediction threshold exceeded^low power condition on`lamp failureavideo acquisition errorbscan head positioning errorcend of user area encountered on this trackdillegal mode for this trackevoltage faultfautomatic document feeder cover upgconfiguration failurehlogical unit not configuredidata loss on logical unitjinformational, refer to logkstate change has occurredlrebuild failure occurredmrecalculate failure occurredncommand to logical unit failedocopy protection key exchange failure - authentication failurepdecompression exception short algorithm id of nnqdecompression exception long algorithm idrsession fixation errorscd control errorUlogical unit is in process of becoming readylogical unit not ready, initializing cmd. requiredlogical unit not ready, manual intervention requiredlogical unit not ready, format in progresslogical unit not ready, rebuild in progresslogical unit not ready, recalculation in progresslogical unit not ready, operation in progresslogical unit not ready, long write in progress logical unit not ready, self-test in progress asymmetric access code 3 (00-232) [proposed] asymmetric access code 1 (00-232) [proposed] asymmetric access code 2 (00-232) [proposed]auxiliary memory code 2 (99-148) [proposed]logical unit communication time-outlogical unit communication parity errorlogical unit communication crc error (ultra-dma/32) warning - specified temperature exceeded warning - enclosure degraded write error - recovered with auto reallocation write error - auto reallocation failed write error - recommend reassignment compression check miscompare error data expansion occurred during compression write error - recovery needed write error - recovery failed write error - loss of streaming write error - padding blocks added auxiliary memory code 4 (99-148) [proposed] copy target device not reachable incorrect copy target device type copy target device data underrun copy target device data overrununrecovered read error - auto reallocate faileddata re-synchronization error unrecovered read error - recommend reassignment unrecovered read error - recommend rewrite the datacannot decompress using declared algorithmerror reading upc/ean numberread error - loss of streamingauxiliary memory code 3 (99-148) [proposed]filemark or setmark not foundrecord not found - recommend reassignmentrecord not found - data auto-reallocatedmechanical positioning errorpositioning error detected by read of mediumdata sync error - data rewrittendata sync error - recommend rewritedata sync error - data auto-reallocateddata sync error - recommend reassignmentrecovered data with positive head offsetrecovered data with negative head offsetrecovered data with retries and/or circ appliedrecovered data using previous sector idrecovered data without ecc - data auto-reallocatedrecovered data without ecc - recommend reassignmentrecovered data without ecc - recommend rewrite recovered data without ecc - data rewrittenrecovered data with error corr. & retries appliedrecovered data - data auto-reallocatedrecovered data - recommend reassignmentrecovered data - recommend rewriterecovered data with ecc - data rewrittendefect list error in primary listdefect list error in grown listprimary defect list not found access controls code 1 (99-314) [proposed] access controls code 2 (99-314) [proposed] access controls code 3 (99-314) [proposed] read type operation while in write capable state write type operation while in read capable state illegal command while in explicit address model illegal command while in implicit address model access controls code 5 (99-245) [proposed] access controls code 6 (99-245) [proposed] access controls code 7 (99-245) [proposed] access controls code 8 (99-245) [proposed]$invalid cdb field while in explicit block address model$invalid cdb field while in implicit block address model&threshold parameters not supported&invalid release of persistent reservation&unsupported target descriptor type code&too many segment descriptors& unsupported segment descriptor type code& invalid operation for copy source or destination& copy segment granularity violation'logical unit software write protected(import or export element accessed)bus device reset function occurred)transceiver mode changed to single-ended)transceiver mode changed to lvd*asymmetric access code 6 (00-232) [proposed]*asymmetric access code 7 (00-232) [proposed],invalid combination of windows specified,current program area is not empty,current program area is empty,illegal power condition request0cannot read medium - unknown format0cannot read medium - incompatible format0cleaning cartridge installed0cannot write medium - unknown format0cannot write medium - incompatible format0cannot format medium - incompatible medium0cannot write - application code mismatch0 current session not fixated for append1zoned formatting failed due to spare linking5unsupported enclosure function5enclosure services unavailable5enclosure services transfer failure5enclosure services transfer refused8esn - power management class event8esn - device busy class event:medium not present - tray closed:medium not present - tray open:medium not present - loadable:medium not present - medium auxiliary memory accessible;tape position error at beginning-of-medium;tape position error at end-of-medium;tape or electronic vertical forms unit not ready;failed to sense bottom-of-form; read past beginning of medium; position past beginning of medium; medium destination element full;medium magazine not accessible;mechanical positioning or changer error>logical unit failed self-test>logical unit unable to update self-test log?changed operating definition?redundancy group created or modified? volume set created or modified?reported luns data has changed?medium auxiliary memory accessibleGdata phase crc error detectedGscsi parity error detected during st data phaseGinformation unit crc error detectedGasynchronous information protection error detectedPposition error related to timingQerase failure - incomplete erase operation detectedUinsufficient reservation resourcesUinsufficient registration resourcesUaccess controls code 4 (99-314) [proposed]Uauxiliary memory code 1 (99-148) [proposed]Zoperator medium removal requestZoperator selected write protectZoperator selected write permit]media failure prediction threshold exceeded]logical unit failure prediction threshold exceeded]spare area exhaustion prediction threshold exceeded]hardware impending failure general hard drive failure]hardware impending failure drive error rate too high]hardware impending failure data error rate too high]hardware impending failure seek error rate too high]hardware impending failure too many block reassigns]hardware impending failure access times too high]hardware impending failure start unit times too high]hardware impending failure channel parametrics]hardware impending failure controller detected]hardware impending failure throughput performance]hardware impending failure seek time performance]hardware impending failure spin-up retry count]hardware impending failure drive calibration retry count] controller impending failure general hard drive failure]!controller impending failure drive error rate too high]"controller impending failure data error rate too high]#controller impending failure seek error rate too high]$controller impending failure too many block reassigns]%controller impending failure access times too high]&controller impending failure start unit times too high]'controller impending failure channel parametrics](controller impending failure controller detected])controller impending failure throughput performance]*controller impending failure seek time performance]+controller impending failure spin-up retry count],controller impending failure drive calibration retry count]0data channel impending failure general hard drive failure]1data channel impending failure drive error rate too high]2data channel impending failure data error rate too high]3data channel impending failure seek error rate too high]4data channel impending failure too many block reassigns]5data channel impending failure access times too high]6data channel impending failure start unit times too high]7data channel impending failure channel parametrics]8data channel impending failure controller detected]9data channel impending failure throughput performance]:data channel impending failure seek time performance];data channel impending failure spin-up retry count]<>|>>>?P????@H@|@@@ALAAAA,B`BBBB,C`CCCD*(J4LAQ/C!8<<+| wzg`?"|l'%q nZo1%;6W.'760(.z P 6$6(X9#HQ3kHX%^Xv]=XQ:M hQ'b5 UW+ 0:b|'=@Vs1cB<C(6E]3s # {g!^ z9,8|gQE 60_Jv_RegisterClasses__gmon_start__libc.so.6putcharstrcpyrcmdioctlsysconfstdoutstrerrorfdopengeteuidgetenv__strtol_internalusleepgetpagesizefgetsmemcpyglobperrorreadlinkputsdup2getuidmallocfflushabort__lxstatstrrchrisinffprintfstrcatsetsockoptstdinwaitferrorstrstrrandsignalreadstrncmpstrncpyrealloc__strdup_IO_getcstrtokforksscanfstrncatexeclpgettimeofdaymemsetfcvtseteuidstrcmpgetpwuidgetpwnamgetservbynamesprintffclosestderrisnanvallocfputcecvt__ctype_b_locglobfreesocketpairfwrite__xstatrewind__errno_location__fxstatsetbufgcvtfopen_IO_putcfilenogetline_IO_stdin_used_exit__libc_start_mainlseek64strchrfcntlsetuidfseeko64fopen64GLIBC_2.3GLIBC_2.1GLIBC_2.0$ii ii ii x_ 6$6 (6N     ćȇ̇Їԇ؇܇!"#$% &'()* +$,(-,.0/4081<2@3D4H5L6P7T8X9\;`<d=h>l@pAtBxC|DEFGHIJKLMOPSTUWXYĈZȈ[̈\Ј]Ԉ^؈`UKV5%%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%ćhx%ȇh%̇h%Їh%ԇh%؇h%܇h%h%hp%h`%hP%h@%h0%h %h%h%h%h% h%h%h%h %h(% h0%$h8p%(h@`%,hHP%0hP@%4hX0%8h` %<hh%@hp%Dhx%Hh%Lh%Ph%Th%Xh%\h%`h%dhp%hh`%lhP%ph@%th0%xh %|h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%Ĉhx%Ȉh%̈h%Јh%Ԉh%؈h1^PTRh\hQVhWUS[ÏRtX[ÐU=,6tvҡu,6ÉUtt hЃvÐUU]R U]UM]Q Q Q UM]QA Q  U]UWVS u }~At: ux < t~ӡ 6D$$V [^_]U(UD$x$l6BT$D$ B D$B D$BD$BD$BD$ 6l6UWVS\]E $D$\$1u %$JU ҉ 1E +46Ћ$D$T$ Dž} Dž99ӉC$5C$861ƅ9։}K=JىQY Gt u_5;|ÍD$T$ D$|$D$$0xt E 9$"\[^_]ÍCD$T$|$ D$T$n#UWVS< ƅDžDžDžDž} EXC<u*u-uuu0uu3u6uu9uu <uu@?uu BuuÁ@6EuuUB<6u*uLE$p9E $|t9E$ix9E$V|9u3uc1I1UӃ=I!BD$ЃD$I$UBIƄI uu $9D$1ƅ9эAu9/t9fǁ9/S)Ѝ\EPƅ1уDŽ kafkfDŽ a$H1уDŽ /mntƄ $1fDŽ)/1уfDŽ ..Ƅ 1fDŽ).yCD$C$D$CƄK$ *I$fD$|*< [1^_]Éѿ9Ɓ9UU B !T!)u ~zXt E E]ÀzAuz uUED$ED$E$ED$ED$$UWV}SlD$PD$ <$p9%=tQ=@m=k= =`\=t&o=,$sEE-E----E----tEr€tEw@tEx tErtEwtExtErtEwD$|u$xEt9D$E$n-x9D$ED$$R-|9D$ED$$6-99D$D$T$ 4$-T6$ 99ȉ/ T$ D$D$4$,JB< w‹fEBEJD$D$Eʼn$,JlED$D$Eȉ$\,E D$ED$$B,E@D$D$EՉ$$,1|uD A~|$ED$ 9D$I$:'l[^_]á99EdElEbȉEcEfUWVS]C $$~ND$|$+46$v)ÃD$|$$[^_]UWVS\=\6uE D$D$A+46$fmE DžAA.tD$`D$$`9N I9I $99F, p9@F <,861I~MJT^!L^"Gt u_I9ЭƀIFd6JۋFJFJF~ t06>uRËu$ÍF$C$x}C 1Iʹщ $}C|$C$D$IC$S1fD/ X6t9~ u~!v-UT$$D$I$`$\6Apu/\[^_]Á p9F <F!fI.Q~!ED$$D$I$D6\$$54$4$F$4$D$ $ID$F!D$F <fI..I$E$D$>"$ã06Uj%D$4$D$$T$H$X<$0$$$$ $H$$$D$$$($h$$$ E$UWVSDžDž} ]DžDž|$$DžDžDžDž"D$LwD$HD$(D$$D$D$D46D$@T6D$ 6$ D$$D$$ 6D$$ $&$D$ 6$ D$a$D$$ 6D$$ *$H&$D$b 6$ D$$D$%$+ 6D$$ $$D$% 6$ D$$D$%$ 6D$$ N`$<$D$Zd$$D$<h$$2D$8$7$MD$ H6D$D$$3.=D$D$$<.H6t<@%;uD$4$D$RaZ21Dž$0/ЉD$D$D$,$$ny$L$D$$D$ $MA/C<  ШB@€C Шu E{nC<  ШB@€C Ш.ED$D$ D$D$$_D$lD$$6$uC$D$BD$ AD$@D$[l$ Ít$EL86=D$D$$086C$D$BD$ AD$@D$$fË $S\$$D$l$1$D$t$$D$x$$D$|$$D$$$,D$$$HD$d&$$_D$F7$$vD$(H$$D$ YD$$D$ $v86JD$$86D$$`$D$D$A+46$$AH`F@6$D$-JD$D$A$F$BA$D$Aйtt L$$D$D$A$*AD$A$:D$_$AIЅtMtVL$$^D$Aйvwg$$F$5<6$D$$ L$$D$AfA$ ҉T$^AD$$GAfA$ ҉T$ AA$$ A A ‰T$T$q=6K,Y"kUWVSh6]}  6u @EЙ}؅]>e 669~Ӊؙ}D$ ËE|$ $D$3x6$5t $IE])DžE[ ^_]É$1D$ Ƹ4$D$T$!Ѓt0]|$4$ \$c9t $[^_]$USt]wED$ $D$D$fD$D$ D$P\$E$6D$$o6D$6$薍6x]%D$66$z6D$<$4t[6@$$6h$t[]뜀}u!D$\$$Mt[]á6h$$&6$Uh6u6$fÉ$ÐUS]$>t{$~1[]É$莖$舛uۉ$赛t$訛t $蛛uUS]$Ԛt$ǚ1҃t[]É$!t1$ t 1[]É$5 u[]É$t$uUVSu^@D$D$l$dCF$CTC CCCUV$ЈCUFD,u[^]ĝUWVS ]C$$lS$BxC$ [^_]ÉS$1$D;} }\$%yNC@@(uՉ$יE$]tuC$~BC$1뗃}:ƒ}0 Шt؃k$ [^_]É$M$lC$UVSu^@4$x [^]0҃{ 4$ĘtI4$記t$ 4$Ey4$莘t&4$聘뙉4$y뤉4$ʘUVSu^@D$D$l$`CTCCC CCUV$ЈCUFD<u[^]ʛUWV}S$C$\$t$X1<([^_]Ëw$t_(~D$N$y̋O$uD$jUWVS,]uD$D$<$E D$D$D$ D$|$$Uf ¸҃ 1Et0   ‹EEtUMtU$tXC$E D$D$D$ D$|$$FFk$U 1td} tfD$D$<$C$UD$D$ |$$D$jU k$1,[^_]ËE U D$D$D$ T$|$$x<t$   ‰$4FFE D$ |$D$$*xCU 6C$~ +D$$ E k$UWVS< D$D$ $6D$T$D$D$ D$E$5f ҃ND$D$D$D$T$ U$ Ex(9 98uuEp(] GD$ GD$GD$G$2MɉtUEP(E MG $1G $1G$1D$ t$\$$ 2UËB(EtE1ҁ< [^_]Á< [^_]û $d)‰Ћ9T$$T$nn9.|$D$ $ Dn9rlG$0G$0G$0D$ t$\$E$d)QD$ G D$G D$G\$$D$ |$$m \$$@UWVS,uD$D$<$D$D$D$ D$|$4$SF(f ҍZD$D$\$ D$|$4$x@F(unE t0   ‹E 1ҁ,[^_]É4$b)‰|$$T$Jl44$]b|$)$\$'loD$$UWVS,u} D$D$$rD$D$D$ D$\$4$zf ҍB=oD$D$D$ D$\$4$$x1t+DT D  ‰1ҁ,[^_]D$$UWVS<Džu} F$4$4n$D$D$$DF$D$ ?D$ \$4$D$D$D$$F D$ ?D$\$4$D$UxV$<9s"$?D$C\9r$ ֧n$<[^_]ËF   D$D$$D$ D$ \$4$D$in$b$D$$  ‰T$$  ‰T$UWV}S\u] 4$<$D$D$, ؈]EEE‹@|$4$$D$ D$ <D$`\[^_]UE]$,<UE]@<UWVSE u}EE^@E싆P$D$D$l@E@CC ECCT(CCUV$ЈCUCVCWCXCYEC[EC\FDu[^_]tnD$$'vMUWVSE u}EE^@E싆H$D$D$l^E@CC ECCTCV$‰SUCVCWECXFD8u[^_]mD$$'eUWVS]M}u 1t 6tM]u }[^_] [^_]UVSEu t$ D$D$$@\$4$iCD$R4$$D$C$D$g4$D$C$<wh{w{tLCD$|4$D$CD$D$4$C D$D$4$[^]À{u{ t뤉t$ D$D$$FC@^C)@ t&ueu;ut$$ t$ D$ D$$ɥɉt$ D$D$$觥C량t$ D$D$$聥Crt$ D$D$$XCAt$ D$D$$/Ct$ D$D$$Ct$ D$D$$ ݤCt$ D$D$$贤}t$ D$D$$菤CLUS]$"C<=yl t&X Y'&>$7E[]==='=t&A=t&>$Dy=[ &de&>$R)=;='t&-c=0=:t&>us$`$s===t&>u3$A  D$$E[]a=Xe=Dv=Et&u$ == =u$$$==J$=3$ =&$=$.q=Y=$?O$MC$Z7$o+$|$$${$$$$$$$$.$>$M{$Yo$fc$rW$K$?$3$'$$UVS]C$s@$k$1҅x [^]Ã~ F+$UDžDžDžDžDžDžB<D$$D$D$D$ D$D$_t MA<t E@<t UB<t MA<t E@<Eu h$|U0 J< 6$D$$ p)MAM9UD$$ M91E@u MA<:ED$$脇U9MA<;MA< EMA<UVSu] \$4$31҅t u[^]É4$US$EE] EttD$ED$D$ED$ D$ED$$1҅ttE E$[]UVSӃމT$D$$bغ颋.$)T$A^$ )\$#[^]UWVS,}$<t ,[^_]ÍD$D$$cD$<$vG$Ɖ\$<$vo$t$É<$R.t$s萼C< <?$p$躄D$!CuD$$<D$!CuD$$D$!CuD$$D$!CuD$$ĻD$!CuD$$蜻D$!CuD$$tD$!CuD$$LD$(!C uD$$$D$;!C uD$$D$O!CuD$$Ժ$ ΂D$dC!uD$$蠺D$~!C uD$$xD$!CuD$$PCt(D$!CuD$$"D$8!{xD$$D$!C@uD$$ҹD$`!CuD$$誹D$!{xD$$肹D$!CuD$$ZCt(D$!CuD$$,D$!C uD$$D$!C@uD$$ܸD$!C uD$$贸D$!CuD$$茸D$,!CuD$$d$ ^D$GC!uD$$0C$ CD$V$m`D$D$ C!uD$$ɷD$<!CuD$$衷D$h!CuD$$yD$!CuD$$wQD$!CuD$$)D$!CuD$$D$!CuD$$ٶ$ ~CfS ¸0CfS ¸CfS ¸{AfSC ¸{C S D$$ЉD$(C<<CfS1$s ҉T$;.|$$ ˵FfV$ ډ\$觵F$$ D$脵غ.$T$h^$ T$N;g?$$fSCC S D$D$ЉD$D$dC!uD$$ִD$!CuD$$讴D$!CuD$$膴D$!CuD$$^C .D$+!CuD$$,D$!CuD$$D$@!CuD$$ܳCD$G$m@D$賳CD$_$mD$腳3${CSD$l$ЉD$OC*UE]BUW}VgfffS)ˍ )ω)ʍ 4 [)^ ω_]UU)E )EMY… Шt ]Áf]UWVS}j|rk)t؉ )il]𻵁NEE))؍] C1r- S[^_]Í^=ǯwWfk)t؉ )ilf]𻵁NEE))؍f|U 1BB[^_]Uk)tWMVu SN )iǔ))V))N[^_]UVS0]u xB~7E4$D$ED$Et$D$ E$D$0[^]ÍE$D$FED$E\$D$ E$D$躰념UWVSLDžU$}t E$GDžDžt DžD$D$$ٞt DžG$<$荤D$U T$ T$<$D$+1t G<$D$U T$ T$<$D$G(o$uMSօuz~ J\<$u6< <  ШuD$ $nG`.^< <  ШuD$ $Nn.^< <  ШuD$ $m.S^< <  ШuD$ $m "u C"uCu.U DM$ m $ Ŋ.EDžTDžP$ jm$D$tD$- $贓V$I mD$ D$ D$$nD$S $QD$ $7lD$ $lD$ $ku$k i5t$v CD$ $k.D$ D$ D$$}m$D$,SD$ $":UWV1S1҃t<[^_]À?uEU<[^_]ÍE<$D$DŽtڀp€P Шt.E1EU*€x Шu$t딀t€T ШtSE1뾃9EȋEUeȉU܋UE؋]܋EUE̋MÉM]܋]܉]5g€G ШtEUSm€M ШtEU/f€F Шt0 iM0 eUs€S ШtEU k€K ШtEU b€B ШtEU w€W ШEUqUVSU EEËE ։ؙ1؉1 u E [^]É\$t$ D$ $vEE [^]UEUEyM QEU6SUt.Zu%6t9tH@uZ16[][]U66M 9tP@u]Ë@1]UVSu6t$$'ht[u1[^]Ã[^]US6D$pD$$6$[uރ[]USE$y1tS؃[]UE]HU]U]U]ÐU*E`{5Pk %@[ %@[u1ÐU]U]U$ÐU]U]U$ÐU]U]U$ÐU]U]U$ tÐU]U]U$@TÐU]U]U$`4ÐU]U]U$ÐU]U]U$ÐU]U]U$ÐU]U]U$ÐU]U]U$ÐU]U]U$ tÐU]U]U$@TÐU]U]U$`)4ÐU]U]U$4ÐU]U]U$>ÐU]U]U$GÐU]U]U$RÐU]U]U$]ÐU]U]U$ dtÐU]U]U$@mTÐU]U]U$`v4ÐU]U]U$ÐU]U]U$ÐU]U]U$ÐU]U]U$ÐU]U]U$ÐU]U]U$ tÐU]U]U$@TÐU]U]U$`4ÐU]U]U$ÐU]U]U$ÐU]U]U$ÐU]U]U$ÐU]U]U$ÐU]U]U$ tÐU]U]U$@TÐUVSt$et11 t$me~4$]e[^]U]U]UWVS,DžMkE$CSD$qqU$Ke1$`bGD$D$1 $dr~Ƃ|$D$$nbD$#$`tD$ $D$ D$du=wwADQDž|$D$$ac<$c4$7aD$D$$1c y\ppu$`D$D$$Dc ~$y`tEE$8bS{CB0CG0C$e,[^_]É,[^_]11ᐐU`)]U(E D$D$$D$ D$ D$  D$ D$, x1Ut3@ ~,D$$7_uË )tU1]UWV1SEUE} EEPh~59~\$ދED$$誓UBh)9}&)D$ED$E$~~9|ڃ[^_]ËUE[^_]UWV1S,}2)=}Í\$$ 9|ʁ,[^_]UWVSUEƉEE E9u5_hx2P> tN9uwɋU[^_]AEt+F ~ED$2 $D$kYČ[^_]ÍUD$P$FED$P$rUD$ D$ D$$e]~+VtugE1D$$*E$F ~(UED$L T$D$ UE$D$蟁[U)=~-E눉c0UWVSEEEE E1}эY[\$E4$D${9t EEEE[^_]UWVSl}Wht8E uD$ D$i D$P4$諏ډt$$&Al[^_]UMQhtD$n $q  UMQhtD$y $| UWVS,E] uHh1ɋ} u'1 u1 u~,[^_]Ë.x㋁tى\$ |$t$D$D$ D$$膎E\$$ U1WVS}] Ohڅ u~ 1[^_]Ë1\$ H$D$D$ D$\$$ [^_]US]Clu$ChCltx u[]É$[҉D$ $ >[]U1WVS}Wh2E ]D$ D$ D$P$N\$$ EPWh]9E|r9]E E $ \GlČ[^_]D$\$ D$D$4$XE-E=‹Wh9.wO ~D$D$ $|}WhEGD$\$ D$D$4$XyfE-E=ƋWh9. W .D$D$ $|<$Č1[^_]ËE맋E%UWVSl}Wht8E uD$ D$ D$P4$艋ډt$$ l[^_]UWVS }Wht4u}u\2x u 1 [^_]ÉD$$ ËGhǀ4$UGh [^_]É$XWhǂ덉$XWhǂi$XWhǂEUWVS]|EE$D$ D$ D$P\E\$$ Ɖ$U1tEt$$؃|[^_]U1VSuM ^ht t v 1[^]$8tAta΋t6뼸)뵸)뮸)막$^h릉$^h뱉$^hUSd]$D$P$D$ D$ D$Ud[]UWVS|}Wh_@G,CDžD$DžCD$C D$CD$CD$D$@D$ $興ƋC D$D$CT$轈s CHSt$D$$s9t +~3D$D$$s;t $ƅC)CaC QC$AC(1 CLCL~-D$C+$$F1C>tt$$~1|[^_]ËC.=@D$D$$#Dž^1C 됃 CL "UWVSDžUEr,@z Zƒ Шd[u^hM u D$:E $WPE pE hu D$!D$t$ $ʅD$:$P|t |D$3$ yP6߅D$@$O)=v\$D$ D$ D$$~/tE@ ~-|$6tT$ D$8$D$v$, Op`$%OSu6ۉl0]4$_R)D$D$D$ $/S!OZ$ND$$PtD$$P$)!u$>RIOuFtu!Ĭ[^_]$dYuL\$|$D$D$T$ $腃볋UBttD$7D$$a$N‰Fh1.xBǂǂǂǂǂǂǂ$M$QׅnUBh8B )|oD$ D$TD$P$\$$YExgE hEEËE\$D$ ht$E$_UBhDžǀĬ[^_]D$^$bL6N$M63D$$r$hr6tIDžpt$D$$\rxDžl!D$$lrB$KNW9t$OMO9tG$KKp$vND$pD$6tT$ D$6@D$$ANuFtsD$wD$$t$Kq%GD$$D$+qD$$JD$$JD$$JlD$/$ MtXD$pt$tD$ D$\$D$l$Klt$$wpQ$@UUM tM UH]J*t~*t1]øQ*UWVSE*E ]*tu t=U $T$UR xCD$ C D$C$D$a\[^_].tE볋EUE]JUVS] u\$4$P9É ШtˉNT^X[^]UVS] u~\$4$9} 1[^]Ë\$4$PFp[^]US]$PCp[]UE]J UE]J(UE]J,UE]J0UU EPd]US$]E$!D$@|hD$ $etaD$$\t $[]D$l$;uD$$'uD$p$1҅t$JUEP@B uJ$uz(u1z+t]UE]@@@UE@@Px@])Ë@]UWVSE!EuX@C(D$tt$D$ E $H|xe} )ǀ{(xi{)C(vLC(f%f=ET$ D$D$t$<${x+U [^_]$C)D$|t$D$ <${.x)ƀ{)pC*D$|t$D$ <${.x)DE[?5+(! UWVSE] uD$ D$!\$E$zxV}(UD$ UD$\$<$zx3)ÃyD$!\$<$zx+U[^_]Ã[^_]UED$ D$ED$ E D$E$3UWVSE}u X@C~Ct +E [^_]ÉD$CD$H|$D$ 4$z….xҋu C)փd~dD$D$|$D$ 4$….xUE@@P TD$&D$ ET$D$E $kɉ!U,WVS|ElEux@G t:<t*]D$ D$HD$@$yڋMADt8tEEM T$D$D$ Rt$L$G$$Sx9] )ËEt$\$$x)ƃ G(u+U |[^_]ËGLt$$D$ G+ED$.x)ƍG(D$MED$L$ t$\$$W.x땅hGMbD$EH`Y؍])‰T$D$D$@D$ $wMt$\$ $J.)U1҉WVS,}]G(~oG@@D$GD$G D$GD$GDD$\$D$ E $awx,u )É<$Ɖ\$t$x)Ã(+U ,[^_]É\$t$<$.xƉ+U US]K|+St$L$)ЉD$&C|[]UWVSEu X@$NjC~Cu +E [^_]ÉD$C|$|$ D$ED$D$4$sv….xNju )Uփd~dD$D$q4$D$ ED$….xUMbWVS}uG@@D$O`Y)‰T$D$,t$D$ E $ux] )Ã(+U [^_]Ét$\$<$.xUWVS}]<$M tE 0t2G$~W(t'E<$D$ED$xq])EËG$~G(t7G@xt+|g@D$$D$ ED$ux,)EG(~*E\$<$D$xÉ+U[^_]ÅyG$ɋED$$D$t.x)EG@nUWVS]Es${(C$C(D$ E $D$D$s${([^_]UVSEu D$\$$~D$\$4$\4$>[^]UU$D$US]K|+St$L$)ЉD$ ED$ C|E[]US]$][]UVS]D$t$$~$D$t$$[$%>[^]UWVS }u]E D$!D$D$D$<$DryE !} [^_])rUED$ E D$ED$$6$UVS EX@$ƋC~Cu [^]ÉD$Ct$ t$D$$6D$$qd~dD$$qD$` [^]UMbVS ]C@@D$K`q)‰T$ D$,D$$6$5q{( [^]]$ [^]\USEX@C~Ct[]ÉD$ CD$HD$$6$pCd~dD$$D$[]UE@@P T$&T$D$YUWVS }E u]D$D$!<$Wpx'B^w/T$D$<$0pyE !} [^_]pD$<$pUED$ E D$ED$$6$[UWVSE] uD$ D$!\$E$MpxX}T$ D$\$<$*px5)Ãx8EEB^vD$\$<$oyˉƒ[^_]D$!\$<$o.xۍ+U[^_]UED$ D$ E D$E$qUE D$ED$$6$UE]@@@(UVSEX@$n1҅tC+$F$.LF >1e>F$uF #F UEU t+t~`+t1]ø+U(E D$D$$D$D$ D$ D$D$1K1UWVSEPhEEEB EE}Ph17DZx$0EPhfDZ~׃E}~ȃEm老}~>t"$3UBhǀǀ1[^_]UWVhS]t$$\$1ux%=`t 1ļ[^_]Ét$\$$1ux%=XD$\$$P3y E1󫍅XD$$13Et4D$$3Dt t~ڃt&t-Uȅt&duBeu BvuB\D$$=UD$8$)UD$h$UD$$UXD$$D$-@=ƄXf1WX/I߹򮍽XʹэL $/ \$$y2򮋅р|/D$/$p0@X|$$/D$PD$$1|$1$411tI.u B.uBuDŽ~ DŽ uDžt1t1򮋽tэ<9t~Ջtu Džtt=x91ƅH t1HfDŽ)G/D$H$.벉|$$/1uӃ $n/B=7HXƄHL$<$K0&X\$D$|$ $H` U̹|ֿt,|iuBdu BeuBED$ D$ D$$,D$ D$ D$1)ЉEԃ$,D$ D$ D$1)ЉE؃$,D$ D$ D$1)ЉE܃$^,M̙|1)ЉiuAdu AeuAt(|(׃B()1ɋph =N $<t%9uN!;u;u~pD$D$$PD$EЅu1||\$ D$D$D$Op.dJhf|AT$t$ L$\$D$l$^O L$D$ẺT$L$ D$D$Bt$\XT$\$D$ D$$NT$ \$D$Hu fDžH/$+xPfTAq $Јq Qhr!r $Ȉr E 0EE  T$$T$D$ẺL$(t$ t$L$T$ D$D$L$\{||HQ҉:Dž(‰(‰҉Xщ $'.XD$$4+|sD$S1D$$)tB ~*D$D$ D$$ZD$SD$ $)#̉@ 򉍀~BL$T$t$L$ D$D$$;Z򉅌ǹ򮋅DM|\$ |$f/LADžUWVSEU@R EEUX@,E}ƒ} Шu~)4%UBtFČ[^_]ËExhou tu t$U :}1}ED$D$D$ $b#UD$D$$T$ $(?#EE%KE$D$ ED$ED$EMEEEUD$$D&Ex ~#U|$ \$D$D$$Wa] tu ttEx ^M t E 8Ed$IUB,$DI$IE$$EE 놐t&##ttt Ex v"Ƌ >u\$D$U$VD$|$ \$D$ U$Vo<$!b$ "UƉBh1.Ydždždždž fdždždž1E~ 1ۋEMph1ҍfDF~~m~U\$D$DT$UD$T$ $GVD$$;xtED$ ED$ED$E $EEUD$ E$D$ED$3EE!D$5$UUBt>tU D$RD$T$ $U1Uz >~"D$|$ \$D$t$TU$Y"UBtD$$TvU]U1VSU w5EXh1t)11ҍf|Cy~~1[^][^]U1VSM ]u u71 u&!EPhtDB[^][^]UD$E@t$4SUEP@hP $t1҅‰]U1U tBwE SU]1"]UWVSuF^@x{ ~C C$1ҁČ[^_]ÍExD$D$,$eED$D$@<$MECCDECtEC 1҅~DTD9S CEȋEċC@ƅ8iCD$S}ЉE܍ED$F$0! Ct43M9t+EȋS9vЉD$L$4$EȋS9v)ЉCC xC(CE$EtCLxC+|C/EC3EC7EC;EC?ECCEC(CGE@tuC C( u,C$tb.+ƒ  к. PC$~ |$D$$PUЀ:uztC$UWVSU] t3rht0Rx9t%ct~A+tt;1[^_]Ã+.t~ ,u߃[^_]ø^,+䋶 .xQ)ڍRȹhЉ)‰T$ )ډi'U)É؉)L$ED$tD$D$ $6yP69US$] D$D$$D$D$ D$ !D$D$}5$D$D$D$D$ D$ !D$,D$4E\$$=$D$D$D$D$ D$ D$XD$w4$[1]UWVSÃLUUu}xDЋM)‹E UttL[^_]ÍEMD$SD$ $N1҅u֋C ~$ED$D$ ED$$CNED$SD$E$ẺUԉMЉE؁{ U~0D$EԉT$D$ EL$D$D$$MEUM EԋUЉMtE܉.U؉EgUWVSEPhEEE9tLfDŽBE}17DZx$sEPhfDZ~׃E}~ȃEm䀁}~>t"$EPhǂǂtXxNfDŽBE17DZx$EPhfDZ~׃E}~1[^_]USÃD$$$D$D$[]UWVS<}Gh NBE EEEE1kUt$ T$U<$T$P$.x׍EED$r"D$$}.xE9E~ED$u"D$$V~E}{E}cE ;EEEE1kUt$ T$U<$T$P$.x׍EED$r"D$$.xE9E~ED$u"D$$~E}{E}cEE1Ut$ T$U<$T$P$xcED$r"$D$8xH_ ~6EUt$D$ET$ D$ED$D$$JE;E}EqE}aE}I]Gh>yt6xW;t x ؃<[^_]ËU 9|U t&UWVS u} F ~|$D$$\IÍ8$1tFhVlډЃ [^_]US]Clu Cl[]É$Cl[]U1VSU w5EXh1t)11ҍf|Cy~~1[^][^]U1VSM ]u u71 u&!EPhtDB[^][^]U]US]Sh9CtAu3ED$"ED$C$x 1Ƀ}[]UWVSLE] PhpE9PtBE}D$"|$4$fx1҅ttstKL[^_]ÍU1ׅEPEZttLMƒL[^_]E|$D$"4$1҅yEt&׉T$D$4$USÃU$f‰U҉Ut ЉEED$"$D$sx[]$8[]UWVSP4|$D$$%x%=`D$<$D$D$<$XD$D$$$1V8Dž\$ CXD$<$D$Mt! vtt  tD$<$D$:[^_]UWVSLUE@h GxG xwxEEU؉D$ED$ED$ ED$ED$E܉$Mu MMw~Whrf f9tD$$[6u܉؃E>u~_ ƉE܅~rEt$D$D$ $nDu܁vN1L[^_]1ҋ_h9t%SfufSЃE.twU.xEE.xMȋ_hЍf|CEYMԅ-;uMȍfDCE؉$?frmǀ ED$"D$$L.*Ghu G,QD$0)ڍRȹhЉ)‰T$ )ډi'U)øQ؉)L$ MЉ$L$B;U  E;EU؉=GhU؉G1{U؉Gh'U؉MfLCUWVSDžPDžLUBJ Z=X\ƒ` Шu~+!MQtn[^_]ËE tUE tKqÃAuU BTu BAuBuDžLE MAhL`} tM 9uwX1\u]L1P1ۅ1P~ UBttPP~ UBttE M 91DžT} M D$ $'=7TډD$`D$D$\D$ D$X$El`UD$ \$D$XD$`D$\TD$Xډ$EL$ rEDžDpPx Hƒ Шu H" MAt>t*H|$t$ T$D$D$$@PEX DžTDž<UT1ۋBhHL$D$D$ $?<1EPh7DBft0Tt$D$\$ T$D$M$>~~TtM D$RD$L$ $>13u `U BaTGDžT8MD$D$L$ $ED$D$$D$ $xE1..D$4$ x{`ډD$\D$ D$X$E.\Xy`PE.4tUBt>tD$D$$=.t.ttMAt>tt$ D$RD$$@=E$> WEHh1f fAyUB ~&D$&D$$6<EHh>y ǁE t U :1 _HQ19`U|$ D$2$D$ N<MD$ $ EHPh>f\B$ 1ۉEɉHh.O1Lǁǁǁǁ fǁfǁǁDžT1T1fDŽQ12fDA~~ჅTT~`D$D$D$\$D$XD$ ;WUB,>tD$T$9:ME  +D$ $,+ED$D$D$ $(E1D$4$dD$"$D$7FڃaD$ `D$\D$X$Em\Xy`PEt 4OM $UBt>tD$|D$$9$;뮋UBt>tD$<D$$m9.z.p.f ])hDžHD$D$ D$$S#hD$T$ D$$$`lDž@tƍFD$ D$ D$$ D$4$(SEDPhf\Bl@t @4uh $2D~ UBtt} hM 9\H1.D$ $1} U Dx1 MAhHf\PL$ |$D$E$DDTUMBtu1@UBttM L$ D$RD$$$7΋MAt>tD$rD$$6c..UBt>tt$ D$RD$$6h $KDU$fUWVS4Dž@4Džr@0~ 4Yh9AV4;P4t04Zh;,(4@ ~)FD$ D$D$4$5V~l4YhtV,(;~4 [^_]ÉЃ$)(V$,_$FDž $$$$ D$D$$,$&,$  Q4AhQ,H61D2T,D $9|Fu),T8$9tFT$D$$4~_$\$,T$0 $9t!\$ D$4BD$D$X%4Ah9,@ D$T$0 $OFt",$;tFD$$D$4,B F F$z pFF)$F,x4B(~FB ~?,AD$A D$AD$AD$ D$D$$24P49Vt 01[^_]Í$F,xbF+N(FLD$D$,$3V$,F$ F F$yHAX<$4X ‹@XD$ BhD$D$$14Yhw.F(8D$D$l$#F+8FDž@<DžHDžDƅVU$ЉڈF4x F+TFLTD$$(D$,$1(,NDž 4$|~!4A`9|Mt@F H4B`uF(F$F "4Xh9H}F$F 4P40UWVSlEE]Cs@xChf~'l[^_]F F$1l[^_]Í}D$D$@<$!ESF>EF EFEFEEFTEF+EiFMEĉ|$D$"C$NjC ~|$D$$.iEԈF(E׉FLK ~&EډD$ ED$PD$$.E؃vFE E$eC`U9}LF$F F tF$uF$E܉F1E1~EF 볉$~~C`uF(F 독ZEtV$uF$~+i~(_FLuFL~-~7u{~8uuF(F+FL'?,F$ƒ Шt ChfxCN$ƒ Шu RxxF(fǀGUEU t+t~,t1]ø,U$1U1]UD$x${UD$$ZUYUA1U,1U]U1]U]U]U1]UUÐUU EP4]US]C\uEC`uMC@uUu]ueChum$0Ctuu][]$$C`t$ C@t$t$t$Cht$$軭Ctt$][]US$1҅D$D$$`*D$ D$D$$CC4CL$C\$C`tp$lC@t]$lCttJCxC|$6$$Et $/څt[]É$1[]US]$$1[]UVSut5*$t$$P趕t$$P$1[^]UWVS\DžDžE DžDžDžtE UP EC,Eƅt U:9t5$6D$$(D$ D$D$$M1}U~4CD$C D$CT$D$ D$ $6$($D$赩څ\[^_]É  uquVD$:$ u7+u~t$U$T$TƄ5G<@D$,$ W.1DžDžDžDžDžDž1:c]1ҁ\[^_]ËU$6D$ T$$"&uRCD$C D$ CD$$ D$$6$%D$ D$D$TD$ D$$6$%덋BDžDžDžD$D$D$ D$E$D$?UEB<(<: ШtSD$:E$t6D$:$. Uƅ D$U$T$EDžDžD$,$\@E .D$!UT$E $$1E t Ct$R1<,iD$4$S8EE .kt$ D$!!ED$U $;$1H} t8D$D$D$D D$ UT$E $#$D$8,E .tыD$t D$ UT$E $#B瀽DžDžD$E$D$ED$ D$!UT$E $"A9. $D$0,„ Шt8t1G $D$]8u-(} .sD$ D$ u .PD$tM\5D$)ЍR@$D$tE=X55\5$S[^_]Ã[^_]Ív$D$lj\$$D$ |$$KUS]$.;\5})@X5t9 @t9u@[]Ã[]1UVSu4$;\5}SX5[t9 Rt92utE 2B[^]$ .tCBSӉNUVSu] 4$u É] [^]^U 6$ÐUWVS }vu$4$>E |$D$E$Xxσ [^_]UWVSEu} uE t:E)Dž~/t$|$E$}Et[^_]ËE[^_]ËE$UEEED$ED$E $1Ʌt;ED$D$E$1ɅxET$$D$ÐUW1VSE] €  Шu+-Uu0E t"A< w30;E}} uދEtߋE 8[^_]ÍAq<< Ш.tω<w7W뤃 qE _E x€X ШSE cU E D$D$E$U ED$E$MU ÐUWVS$EE}E €  Шu+-Uu0E EE؉ULp;u}uE]ue]܉щEЉً]]EЉUEMԋUUt4A< vAY<€ Шtpvp;u|Et ]U]E UMH$[^_]Ã!EEx€X ШEU E D$D$E$mÐU$ ¸tEBE B881US8]tB$D$R8£8u$UWVS u"$4$$… 1Ҩu [^_]UWVSÃL!xN4$tbU T$UD$|$T$ $hqu L[^_]É4$L[^_]ËE D$ U|$$sqT$Eȉt$ D$zqD$$EwUEUD$E $16US]  U\$$1[]UEUD$E $US] U\$$¸[]UE D$pqD$ ED$$6$ ÐUVSM EUxt y؉ É ÉЉу‰~?yӃ~ [^]È[^]ÐU<,„ кtÉL$$qɉUVSAu_€- Шu1=[^]UWVS\E] :<-<-<+t{DžDžDžuIUDžE ?-M}tM EPB< Ȩt DžU -\t:$d5D$ t& +1;tK빃: uv{uF<, ШtыE<+=1tu1;u<&tV,1t7&1}t ,1uɋu;t *H?$q{t&,1t7&1}t ,1uɋEM <VB< ȃEP;.G;u.=~,v0Nl€L Ш$Fu+&1}t ,1uɄtEt u1;}|;}`^y>t߀,„ ШuȀi€I Шul€L ШF;|DŽfDŽYƄw-+!E1.M Dž;-bDž{K\[^_]À~ ;Qvs€S Шt Ffc€C Шt FlVB< ȨD$$.1;.;.8ZuF<+t+BxFWN,„ ШtAi뷀l€L ШtNFt$$&؃[^_]D$ D$D$$tD$$N뭉5D$E $xu1늋E $1xUWVSEUB:EEBX~EUJuR$xM4$L$׃yED$E$׋UBtM$ L$׃yE[^_]USӋR ȃ5uS []USӋR ȃ5uS []USӋR ȃ5uS []UWV}S_ 1҃5Ɉu_ [^_]UWVSEEB}EU1FуMV,M~ E+}~}t,~$ t&V(:tED$$V(UV(:uFuF$x؋U$T$UyF,t~$ tsE>E$0D$UmyUtMEL$$UUu^tM$ L$UyE[^_]ËV(:.tML$$V(UV(:uaF9)ȉEvUVSø,st1N؅x&ȋVx t  yF[^]CUWVS DžDžEU uDž%M $L$U<%u׍ƅ1҉DžDž DžDžà w$\sĜ [^_]À*DžӃDBЉC< v݀.Dž$;s|$U$As|$|$$$Es‰D$覻BCwC$s0EEۉM-ݍ?tDž#sDžbZDž>-DžDžDžDžUS1ۃ1tRtRttGƒtu{1t"tJttƒtuЃ[]Ƀ롃…Up1҅tUÐUE]UE$ÐUSÃE$tuE$1҅u[]D$6$D$6$ UWVS,E u$E~,[^_]ÍE]D$ED$ ED$E $MNjEETM9~ 9t-UUt t Ѓ.Ex1tEm~u+E,[^_]ËU0.yEm0)5UWVS,E u}$EY~,[^_]ÍE]D$ED$ GD$E $"WEEEEtW9~ 9ut-t.t~ueEك+E1E)E}c~,EQE)B0R)EEgfffE)B0҃)UE0+E,[^_]ÐUWVUu} E҉uEUu9vMEu 9}v1EU^_ÐEǃuM;uw U19UrҿˍvEu11E1uEEuU^_Ð )EUEM ‰eUMEM Ɖu։eE9w?;E6O0UWV0UE׍MƋU EEEME܉Uu>9MɉUtE܉EEEUMHEU0^_É;}vUM̉UMEUEU0^_ǃEua9}w9urŰE)E܉ŰUtE܋ỦEUMEUQ녅u 1ƋẺE܉U= +EԉE؉MMM׊M؋U E̊ME̊M؋E ẺE̊MUe;ỦEw uE9Ev M)MȋEM̋E+EщM̉ʊMMԉE ‹EUEUWVS [f E)19s׉M)F9Ήr [^_ÉUWVS[ ) pNu. [^_ÐUSR vЋuX[US[ïP.Y[JanFebMarAprMayJunJulAugSepOctNovDec%4d: %4d %x %.*s PXPNSLNMCLPLRETFSPAAWarning - host_name requested**BAD RRVERSION (%d) %3ld%4lo%10lld%2d%4d[%7d %02X]%s %s %s Directory listing of %s Options: -help,-h Print this help -p Print Path Table defaultCD001/ISO-9660 image not specified rbUnable to open %s iso8859-1Bad Argument: '%s' CD-ROM is in ISO 9660 formatSystem id: Volume id: Volume set id: Publisher id: Data preparer id: Application id: Copyright File id: Abstract File id: Bibliographic File id: Volume set size is: %d Logical block size is: %d Volume size is: %d EL TORITO SPECIFICATIONCDROMBad Option: '%s' linux-gnui6862.01isoinfo %s (%s-%s-%s) Path table size is: %d L Path table start: %d L Path opt table start: %d M Path table start: %d M Path opt table start: %d Creation Date: %s Modification Date: %s Expiration Date: %s Effective Date: %s File structure version: %d Unable to find Joliet SVD Eltorito validation header: Hid %d PPCMACUnknown Arch Arch %d (%s) ID '%.23s' Key %X %X not bootableIllegal Bootid %X (%s) Illegal BootmediaNO Rock Ridge presentNO Joliet presentx86Hard Disk Emulation Boot media %X (%s) Load segment %X Sys type %X Nsect %X Bootoff %lX %ld 2.88MB Floppy1.44MB FloppyNo Emulation Boot1200 Floppy%4.4s %2.2s %2.2s %2.2s:%2.2s:%2.2s.%2.2sPath table starts at block %d, size %d Reserved bit setting in symlinkWarning - mount point requestedIncorrect length in symlink componentUsage: %s [options] -i filename -version Print version info and exit -debug Print additional debug info -d Print information from the primary volume descriptor -f Generate output similar to 'find . -print' -J Print information from Joliet extensions -j charset Use charset to display Joliet file names -l Generate output similar to 'ls -lR' -R Print information from Rock Ridge extensions -s Print file size infos in multiples of sector size (%ld bytes). -N sector Sector number where ISO image should start on CD -T sector Sector number where actual session starts on CD -i filename Filename to read ISO-9660 image from dev=target SCSI target to use as CD/DVD-Recorder -x pathname Extract specified file to stdout help,h,version,debug,d,p,i*,dev*,J,R,l,x*,f,s,N#l,T#l,j*CD-ROM is NOT in ISO 9660 formatCD-ROM uses ISO 9660:1999 relaxed formatVolume set sequence number is: %d El Torito VD version %d found, boot catalog is in sector %d Only one of -i or dev= allowed CD-ROM is in High Sierra formatUnknown charset: %s Known charsets are: Joliet escape sequence 0: '%c' 1: '%c' 2: '%c' 3: '%c' Don't know what ucs_level == %d means Root directory extent: %d size: %d Warning: Joliet escape sequence uses illegal space at offset 3 Joliet with UCS level %d found Rock Ridge signatures version %d found Eltorito defaultboot header:Bad Rock Ridge signatures found (SU record missing)Apple signatures version %d found QßQQQQvQQQQQQQBQQQQQQQQQQQQQQQ ֹRead error on old image Seek error on old image . %s%sCannot open SCSI driver. Cannot get SCSI I/O buffer. test unit readyrezero unitrequest_senseinquiryInquiry Data :read capacitySectorsize: %ld Bytes medium load/unloadprevent/allow medium removalstart/stop unitset streamingscsi_set_streamingset cd speedqic 02write_g0write_g1write_g5seek_g0seek_g1flush cacheread bufferwrite_bufferread subchannelread tocread headerread disk inforead track inforeserve trackreserve_track_rzoneread dvd structuresend opcclose track/sessionread master cuesend_cue_sheetread buffer capBFree: %ld K BSize: %ld K blank unitscsi_format: preparingformat unitscsi_format: running- [unable to fork()]mode sense g1Mode Sense Datamode sense g0Mode Sense Data (converted)SaveSet %s Mode Parametersmode select g1mode select g0Cannot read TOC header CD-Text len: %d wctbcdtext.datCannot read CD-Text header Cannot read CD-Text Cannot read TOC TOC data: ENT: B0 lout: %ld B0: B0 start: %ld tocheader: Session info too big. Pages: 0x%X Density: 0x%X Blocks: %ld Blocklen:%ld read_g1capacity_not_setread_g0Device type : Version : %d Response Format: %d Vendor_info : '%.8s' Identifikation : '%.16s' Revision : '%.4s' Capabilities : SOFTRESET CMDQUE LINKED SYNC WBUS16 WBUS32 RELADR TERMIOP AENC Device seems to be: Adaptec 4010Kodak PCD-600Sysgen SC4000Matsushita CW-7501Generic mmc2 DVD-R/DVD-RWGeneric mmc CD-ROMMissing Entry for dev %dPioneer DVD-R S101Plasmon RF-4100Emulex MD23Sony CDU-924SGeneric mmc2 DVD-ROMPhilips old CDD-521Ricoh RO-1420CPhilips CDD-2600Sony SMO-C501Adaptec 5500Generic NON CCS DiskAdaptec 4000Adaptec 4070Philips CDD-2000Maxtor RXT800SMatsushita CW-7502unknownBerthold HR-ScannerRicoh RO-1060CAdaptec 4000/4010/4070Generic CCS DiskAdaptec 4520AGeneric mmc CD-RPhilips CDD-521Yamaha CDR-100Emulex MT02Adaptec 4525Emulex MD21Microtek MS300APhilips CDD-522Yamaha CDR-400Pioneer DW-S114XGeneric mmc CD-RWGeneric CD-ROMTeac CD-R50ScaddythisTry to load media by hand. CD capabilitiesInquiry Data : RXT-800SACERCREATIVEGRUNDIGJVCMITSBISHMITSUMIOPTIMAPHILIPSIMSKODAKHPPINNACLEPIONEERPLASMONPLEXTORRICOHSAFSANYOSONYTEACTRAXDATATraxdataT.YUDENWPIYAMAHAMATSHITACDS615EBERTHOLDEMULEXADAPTECCR-4020CCDR2000CDD521/00CDD521/02CDD521CDD522PCD225KHSW/OBCDR-240CDD20CDD26C4324/C4325CD-Writer 6020CDR100IPWXR-W2001XR-W2010R2626CD-R 650ACB-4520ACB-4525RCD-1000RCD5020RCD5040RCD 4X4CD-WO DW-S114XCD-WO DR-R504XDVD-R DVR-S101RF4100CDR4220CD-R PX-R24CSRO1060CCD-R2004CD-R2006 CD-R2006PLUSCD-RW226CD-R4012CD-R CDU92CD-R CDU94CDR4120CD-R55SCD-WO CRD-R24SCD-WO EW-50CDR10CDR200CDR400CDR-632PCD-R CW-7501CD-R CW-7502 %s: %5d kB/s (CD %3ux, DVD %2ux) 32162424 (I2S)traypop-upreserved(3)disc changercartridge changerreserved(6)reserved(7)CLV/PCAVreserved(2) Drive capabilities, per MMC page 2A: read CD-R medianot Does %s%s write CD-R mediaread CD-RW mediawrite CD-RW mediaread DVD-ROM mediaread DVD-R mediawrite DVD-R mediaread DVD-RAM mediawrite DVD-RAM mediasupport test writingread Mode 2 Form 1 blocksread Mode 2 Form 2 blocksread digital audio blocksread multi-session CDsread CD bar coderead R-W subcode informationreturn CD ISRC informationsupport C2 error pointersdeliver composite A/V dataplay audio CDsLoading mechanism type %s: %s Is %s%s support changing side of diskMaximum read speedCurrent read speedMaximum write speedCurrent write speedBuffer size in KB %s: %d Write speed # %d: %s MMC-2send digital data LSB-firstLength of data in BCLKsRotational control selected MMC-3Capacity: %ld Blocks = %ld kBytes = %ld MBytes = %ld prMB scsi_format: post processing %d Formating in progress: 0.00 %% done. Formating in progress: %.2f %% done [%d]. Formating in progress: 100.00 %% done. Mode Parameters (un-converted)Cannot load media with %s drive! error: %d scb.chk: %d sense_count: %d sense.code: 0x%x restart non-streamed digital audio reads accuratelysupport Buffer-Underrun-Free recordingread fixed-packet CD media using Method 2return R-W subcode de-interleaved and error-correctedread raw P-W subcode data from lead inreturn CD media catalog numbersupport ejection of CD via START/STOP commandlock media on power up via prevent jumperallow media to be locked in the drive via PREVENT/ALLOW commandcurrently in a media-locked statehave load-empty-slot-in-changer featuresupport Individual Disk Present feature Number of supported write speeds: %d Number of volume control levelssupport individual volume control setting for each channelsupport independent mute setting for each channelsupport digital output on port 1support digital output on port 2set LRCK high for left-channel datahave valid data on falling edge of clockCopy management revision supported:zD7Mb?|YFFM ATIP start of lead out: %ld (%02d:%02d/%02d) ATIP start of lead in: %ld (%02d:%02d/%02d) Mode Page DataCannot get default %s data. Cannot get %s mask. Cannot get %s data. Cannot get saved %s data. Mode Select DataWarning: controller returns wrong page %X for %s page (%X). Warning: controller creates hard SCSI failure when retrieving %s page. Warning: controller does not support %s page. Warning: controller returns zero sized %s page. Warning: controller returns wrong size for %s page. Warning: using default %s data. /etc/cdrecord.conf,:/@%s=CDR_DEVICECDR_DEVICE=CDR_FIFOSIZEBad fifo size environment. CDR_SPEEDBad speed environment. CDR_SPEED=CDR_FIFOSIZE=Bad fifo size in defaults. Value %lld is too large for data type 'long'. cp437cp737cp775cp850cp852cp855cp857cp860cp861cp862cp863cp864cp865cp866cp869cp874cp1250cp1251iso8859-2iso8859-3iso8859-4iso8859-5iso8859-6iso8859-7iso8859-8iso8859-9iso8859-14iso8859-15koi8-rkoi8-ucp10000cp10006cp10007cp10029cp10079cp10081%x%xREMOTE:rscsi@host:1,2,0rscsi@host:bus,target,lunREMOTE:Remote SCSIRSCSIProtocol error (got %s). Remote status(%s): %d '%s'. R%d A isatapiI initiator idT%d %d %d %d filenoB%d %d havebusF freebufM%ld getbufsndsize: %d rcvsize: %d D%ld maxdmacloseV%d versionS%d %d %d %d %d sendcmdREMOTE%.*sRSHdup2 failed. Illegal remote device syntaxO%s opentcpshellCannot create socketpair. /opt/schily/sbin/rscsiUnknown user: %s rshshell/tcp: unknown service setuid(%lld) failed. seteuid(%lld) failed. -lexeclp '%s' failed. Lost connection to remote host ?? locuser: '%s' rscsiuser: '%s' host: '%s' Warning: Using remote SCSI interface. Illegal value for busno, target or lun '%d,%d,%d'who are you? No passwd entry found. Cannot get connection to remote hostrcmdsh: fork to lose parent failed. ===w=w=w=w=w=w=w====yesYESstatus: 0x%x Reserved(%s%s) host adapter detected errorBUSYINTERMEDIATE GOOD STATUSRESERVATION CONFLICTCHECK CONDITIONCONDITION MET/GOOD %02XSense Bytes:Write Data: CDB: retryable errorfatal errorerror: %d%s: scsi sendcmd: %s no errorReceived Data: resid: %d DMA overrun, %cvendor specific %d unknown device type 0x%xRemovable not present unsupported reserved unsupported TapeWORMProcessorPrinterunit not presentWell known lunAutomation/Drive InterfaceObject based storageBridging expanderOptical card r/wSimple direct accessEnclosure servicesStorage arrayIT8 2IT8 1CommunicationJuke BoxOptical Storageunknown/no deviceSCSI ALREADY RUNNING !!INTERMEDIATE CONDITION MET/GOODSending %d (0x%X) bytes of data. SCSI command name not set by callercmd timeout after %ld.%03ld (%d) s Executing '%s' command on Bus %d Target %d, Lun %d timeout %ds Got %d (0x%X), expecting %d (0x%X) bytes of data. cmd finished after %ld.%03lds timeout %ds Cannot send SCSI cmd via ioctl ret < 0 errno: %d ux_errno: %d error: %d Currently running '%s' command. LPK>LPKHLPKPKPKLPKPKPKPKPKPKPK LPKPKPK*LPKPKPK4LZY,Z"ZZZZZZZZZZZZZ|ZoZeZfYfYfYfYfYfYfYfYfYfYfY[Z6Zscgo_send(%s) wrote %d bytes (expected %d). DMA (read) overrun by %d bytes (requested %d bytes). ATA Packet specific SCSI transportEXAMPLE: /dev/scsi/host1/bus2/target3/lun4/cd EXAMPLE: /dev/ide/host0/bus0/target1/lun0/cd EXAMPLE: /dev/hda or /dev/sr0 ERROR: in scgo_get_first_free_shillybus(...). Too many CDROMs, more than %iIncrease MAX_SCHILLY_HOSTS in scsi-linux-ata.c and recompile!ERROR: unknow subsystem (%s) in (%s) ERROR: this cdrom is already mapped %s(%d,%d,%d) INFO: subsystem %s: h %i, b %i, t %i, l %iERROR: with link merging! base %s link %s, result of merging %i ERROR: with link reading! link %s, result of readlink %i INFO: /dev/%s, (host%d/bus%d/target%d/lun%d) will be mapped on the schilly bus No %d (%d,%d,%d) INFO: Bus: %d Target: %d Lun: %d Chan: %d Ino: %d try open(%s) return %i errno %i calling sg_mapdev(...) Warning: Using ATA Packet interface. Warning: The related Linux kernel interface code seems to be unmaintained. Warning: There is absolutely NO DMA, operations thus are slow. errno (EACCESS), you don't have the needed rights for %s try open(%s) return %i, errno %i, trying next cdrom Illegal value for bus, target or lun '%d,%d,%d'try open(%s) return %i, errno %i, cancel INFO: scan_internal(...) failedNOT IMPELEMENTED: scgo_initiator_idioctl(CDROM_SEND_PACKET) ret: %d Generic transport independent SCSISCSI transport for ATAPI over Parallel PortATA Packet specific SCSI transport using sg interfaceBus: %d Target: %d Lun: %d Chan: %d Ino: %d Target (%d,%d,%d): DMA max %d old max: %ld Warning Linux Bus mapping botch. SCSI Bus: %d (mapped from %d) Linux sg driver version: %d.%d.%d Use of ATA is preferred over ATAPI. SCSI unsupported with '/dev/hd*'DMA addr: 0x%8.8lX size: %d - using copy buffer pack_len: %d, reply_len: %d pack_id: %d result: %d sense[0]: %02X Allocated DMA copy buffer, addr: 0x%8.8lX size: %ld host_status: %02X driver_status: %02X No remote SCSI transport available. Can't do %d byte command. ATAPI:1,2,0ATAPI:ERROR: unknow format INFO: %s -> %s srINFO: l1: 0x%lX l2: 0x%lX ATAPI/dev/cdroms/cdrom*/dev/hd[a-z]INFO: do scgo_open openbydevCannot open '%s'schily - Red Hat%d.%d.%dsgpgATA:scgo_getbuf: %ld bytes Cannot set SG_SET_TIMEOUT. Bus: %d cookie: %X file (%d,%d,%d): %d /dev/hd/dev/scd[0-9]/dev/scd[0-9][0-9]Cannot open '/dev/scd*'PP Bus: %d /dev/pg%dCannot open '/dev/hd*'/dev/pg[0-9]/dev/pg[0-9][0-9]Cannot open '/dev/pg*'ioctl ret: %d None.SCSI open usage error. Supported SCSI transports for this platform:WARNING: device not valid, trying to use default target... scsibus: %d target: %d lun: %d Invalid value for bus, target or lun (%d,%d,%d)Invalid bus or target specifier in '%s'Invalid target or lun specifier in '%s'scg__open(%s) %d,%d,%d HELPhelpscsidev: '%s' devname: '%s' No memory for SCSI structureInvalid lun specifier '%s'Invalid lun specifier in '%s'No Additional SenseRecovered ErrorNot ReadyMedium ErrorHardware ErrorIllegal RequestUnit AttentionData ProtectBlank CheckVendor UniqueCopy AbortedAborted CommandEqualVolume OverflowMiscompareno write currentexcessive write errorsunreachable copy target tracking servo failure focus servo failure spindle servo failure head select fault block not compressible third party device failureread retries exhaustederror too long to correctmultiple read errorsl-ec uncorrectable errorcirc unrecovered errorincomplete block read no gap found miscorrected error de-compression crc errorerror reading isrc numberrecord not foundend-of-data not foundblock sequence errorrecovered data with retriesrecovered data with circrecovered data with l-ecrecovered data with linkingdefect list not availablegrown defect list not found!invalid element address!invalid address for write$cdb decryption error&parameter not supported&parameter value invalid&data decryption error&too many target descriptors& unexpected inexact segment& inline data length exceeded'hardware write protected'associated write protect'persistent write protect'permanent write protect'conditional write protect)power on occurred)scsi bus reset occurred)device internal reset*mode parameters changed*log parameters changed*reservations preempted*reservations released*registrations preempted,too many windows specified,persistent prevent conflict0cleaning failure0medium not formatted1format command failed2defect list update failure8esn - media class event;slew failure;paper jam;failed to sense top-of-form;reposition error; read past end of medium; position past end of medium;medium source element empty;end of medium reached;medium magazine removed;medium magazine inserted;medium magazine locked;medium magazine unlocked>logical unit failure>timeout on logical unit?microcode has been changed?inquiry data has changed?component device attached?device identifier changed?redundancy group deleted?spare created or modified? spare deleted? volume set deleted? volume set deassigned? volume set reassigned?echo buffer overwritten?medium loadablePwrite append position errorSunload tape failureSmedium removal preventedUsystem buffer fullUinsufficient resources[threshold condition met[log counter at maximum[log list codes exhausted\spindles synchronized\spindles not synchronized^Bpower state change to idle^Epower state change to sleepaunable to acquire videoaout of focusdinvalid packet sizegadd logical unit failedgassign failure occurrediparity/data mismatchkredundancy level got betterkredundancy level got worsesprogram memory area is fullsrma/pma is almost fullinvalid sense code 0x%Xvendor unique sense code 0x%X[]no sense, deferred error [No matching qualifier](illegal block length end of medium file mark detected (valid) (not valid) Sense flags: Blk %d %s%s%s%sinvalid sensekeyactual retry count %doperation %d%% done(valid)command(not valid) disk not inserted load/unload failure spindle failure focus failuretracking failurebias magnet failure#illegal function for medium type8recoverable write error9write error recovery failed:defect list update failed=defect list not availablelimited laser lifelaser focus coil over-currentlaser tracking coil over-currenttemperature alarmECC error during verifyinterleave errorbad format on driveself test faileddefective track#volume overflow+set limit violation,error counter overflow-initiator detected error.scsi parity error/adapter parity errorno additional sense informationfilemark detectedend-of-partition/medium detectedsetmark detectedbeginning-of-partition/medium detectedend-of-data detectedi/o process terminatedaudio play operation in progressaudio play operation pausedaudio play operation successfully completedaudio play operation stopped due to errorno current audio status to returnoperation in progresscleaning requestedno index/sector signalno seek completeperipheral device write faultlogical unit not ready, cause not reportablelogical unit does not respond to selectionno reference position foundmultiple peripheral devices selectedlogical unit communication failure track following error error log overflow warning write error error detected by third party temporary initiatorid crc or ecc errorunrecovered read erroraddress mark not found for id fieldaddress mark not found for data fieldrecorded entity not foundrandom positioning errordata synchronization mark errorrecovered data with no error correction appliedrecovered data with error correction applieddefect list errorparameter list length errorsynchronous data transfer errordefect list not foundmiscompare during verify operationrecovered id with ecc correctionpartial defect list transfer invalid command operation code!logical block address out of range"illegal function (use 20 00, 24 00, or 26 00)$invalid field in cdb%logical unit not supported&invalid field in parameter list'write protected(not ready to ready change, medium may have changed)power on, reset, or bus device reset occurred*parameters changed+copy cannot execute since host cannot disconnect,command sequence error-overwrite error on update in place.insufficient time for operation/commands cleared by another initiator0incompatible medium installed1medium format corrupted2no defect spare location available3tape length error4enclosure failure5enclosure services failure6ribbon, ink, or toner failure7rounded parameter8event status notification9saving parameters not supported:medium not present;sequential positioning error=invalid bits in identify message>logical unit has not self-configured yet?target operating conditions have changed@ram failure (should use 40 nn)@diagnostic failure on component nn (80h-ffh)Adata path failure (should use 40 nn)Bpower-on or self-test failure (should use 40 nn)Cmessage errorDinternal target failureEselect or reselect failureFunsuccessful soft resetGscsi parity errorHinitiator detected error message receivedIinvalid message errorJcommand phase errorKdata phase errorLlogical unit failed self-configurationMtagged overlapped commands (nn = queue tag)Noverlapped commands attemptedPwrite append errorQerase failureRcartridge faultSmedia load or eject failedTscsi to host system interface failureUsystem resource failureWunable to recover table-of-contentsXgeneration does not existYupdated block readZoperator request or state change input[log exception\rpl status change]failure prediction threshold exceeded^low power condition on`lamp failureavideo acquisition errorbscan head positioning errorcend of user area encountered on this trackdillegal mode for this trackevoltage faultfautomatic document feeder cover upgconfiguration failurehlogical unit not configuredidata loss on logical unitjinformational, refer to logkstate change has occurredlrebuild failure occurredmrecalculate failure occurredncommand to logical unit failedocopy protection key exchange failure - authentication failurepdecompression exception short algorithm id of nnqdecompression exception long algorithm idrsession fixation errorscd control error֪0֪֪ulogical unit is in process of becoming readylogical unit not ready, initializing cmd. requiredlogical unit not ready, manual intervention requiredlogical unit not ready, format in progresslogical unit not ready, rebuild in progresslogical unit not ready, recalculation in progresslogical unit not ready, operation in progresslogical unit not ready, long write in progress logical unit not ready, self-test in progress asymmetric access code 3 (00-232) [proposed] asymmetric access code 1 (00-232) [proposed] asymmetric access code 2 (00-232) [proposed]auxiliary memory code 2 (99-148) [proposed]logical unit communication time-outlogical unit communication parity errorlogical unit communication crc error (ultra-dma/32) warning - specified temperature exceeded warning - enclosure degraded write error - recovered with auto reallocation write error - auto reallocation failed write error - recommend reassignment compression check miscompare error data expansion occurred during compression write error - recovery needed write error - recovery failed write error - loss of streaming write error - padding blocks added auxiliary memory code 4 (99-148) [proposed] copy target device not reachable incorrect copy target device type copy target device data underrun copy target device data overrununrecovered read error - auto reallocate faileddata re-synchronization error unrecovered read error - recommend reassignment unrecovered read error - recommend rewrite the datacannot decompress using declared algorithmerror reading upc/ean numberread error - loss of streamingauxiliary memory code 3 (99-148) [proposed]filemark or setmark not foundrecord not found - recommend reassignmentrecord not found - data auto-reallocatedmechanical positioning errorpositioning error detected by read of mediumdata sync error - data rewrittendata sync error - recommend rewritedata sync error - data auto-reallocateddata sync error - recommend reassignmentrecovered data with positive head offsetrecovered data with negative head offsetrecovered data with retries and/or circ appliedrecovered data using previous sector idrecovered data without ecc - data auto-reallocatedrecovered data without ecc - recommend reassignmentrecovered data without ecc - recommend rewrite recovered data without ecc - data rewrittenrecovered data with error corr. & retries appliedrecovered data - data auto-reallocatedrecovered data - recommend reassignmentrecovered data - recommend rewriterecovered data with ecc - data rewrittendefect list error in primary listdefect list error in grown listprimary defect list not found access controls code 1 (99-314) [proposed] access controls code 2 (99-314) [proposed] access controls code 3 (99-314) [proposed] read type operation while in write capable state write type operation while in read capable state illegal command while in explicit address model illegal command while in implicit address model access controls code 5 (99-245) [proposed] access controls code 6 (99-245) [proposed] access controls code 7 (99-245) [proposed] access controls code 8 (99-245) [proposed]$invalid cdb field while in explicit block address model$invalid cdb field while in implicit block address model&threshold parameters not supported&invalid release of persistent reservation&unsupported target descriptor type code&too many segment descriptors& unsupported segment descriptor type code& invalid operation for copy source or destination& copy segment granularity violation'logical unit software write protected(import or export element accessed)bus device reset function occurred)transceiver mode changed to single-ended)transceiver mode changed to lvd*asymmetric access code 6 (00-232) [proposed]*asymmetric access code 7 (00-232) [proposed],invalid combination of windows specified,current program area is not empty,current program area is empty,illegal power condition request0cannot read medium - unknown format0cannot read medium - incompatible format0cleaning cartridge installed0cannot write medium - unknown format0cannot write medium - incompatible format0cannot format medium - incompatible medium0cannot write - application code mismatch0 current session not fixated for append1zoned formatting failed due to spare linking5unsupported enclosure function5enclosure services unavailable5enclosure services transfer failure5enclosure services transfer refused8esn - power management class event8esn - device busy class event:medium not present - tray closed:medium not present - tray open:medium not present - loadable:medium not present - medium auxiliary memory accessible;tape position error at beginning-of-medium;tape position error at end-of-medium;tape or electronic vertical forms unit not ready;failed to sense bottom-of-form; read past beginning of medium; position past beginning of medium; medium destination element full;medium magazine not accessible;mechanical positioning or changer error>logical unit failed self-test>logical unit unable to update self-test log?changed operating definition?redundancy group created or modified? volume set created or modified?reported luns data has changed?medium auxiliary memory accessibleGdata phase crc error detectedGscsi parity error detected during st data phaseGinformation unit crc error detectedGasynchronous information protection error detectedPposition error related to timingQerase failure - incomplete erase operation detectedUinsufficient reservation resourcesUinsufficient registration resourcesUaccess controls code 4 (99-314) [proposed]Uauxiliary memory code 1 (99-148) [proposed]Zoperator medium removal requestZoperator selected write protectZoperator selected write permit]media failure prediction threshold exceeded]logical unit failure prediction threshold exceeded]spare area exhaustion prediction threshold exceeded]hardware impending failure general hard drive failure]hardware impending failure drive error rate too high]hardware impending failure data error rate too high]hardware impending failure seek error rate too high]hardware impending failure too many block reassigns]hardware impending failure access times too high]hardware impending failure start unit times too high]hardware impending failure channel parametrics]hardware impending failure controller detected]hardware impending failure throughput performance]hardware impending failure seek time performance]hardware impending failure spin-up retry count]hardware impending failure drive calibration retry count] controller impending failure general hard drive failure]!controller impending failure drive error rate too high]"controller impending failure data error rate too high]#controller impending failure seek error rate too high]$controller impending failure too many block reassigns]%controller impending failure access times too high]&controller impending failure start unit times too high]'controller impending failure channel parametrics](controller impending failure controller detected])controller impending failure throughput performance]*controller impending failure seek time performance]+controller impending failure spin-up retry count],controller impending failure drive calibration retry count]0data channel impending failure general hard drive failure]1data channel impending failure drive error rate too high]2data channel impending failure data error rate too high]3data channel impending failure seek error rate too high]4data channel impending failure too many block reassigns]5data channel impending failure access times too high]6data channel impending failure start unit times too high]7data channel impending failure channel parametrics]8data channel impending failure controller detected]9data channel impending failure throughput performance]:data channel impending failure seek time performance];data channel impending failure spin-up retry count]N^n~Βޒ.>N^n~Γޓ.>N^n~Δޔ.>N^n~Εޕ.>N^n~ '4FR^cgf*k*  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ P+U+  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠ p+u+  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%e"d"H""" %ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   ++  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~#BVW+yM"Z[*{|z A%%%%$% c%Q%W%]%.`%%4%,%%%<%rjZ%T%i%f%`%P%l%} /ask~% %%%%%%LCD67;<FE   "%     ͺްЀӷ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~噞 @@++  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%%%%$%c%Q%W%]%%%4%,%%%<%Z%T%i%f%`%P%l%1% %%%% %@@@@ͺ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Ͼ󨷵ǎԐѥ噞ᅠƄФ ``++  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~oBPQy9:=>Z[deA }~z _%%%%$%^c%Q%W%]%{|%%4%,%%%<%Z%T%i%f%`%P%l%G% %%%bn%CDH`aTUpcqXY%````ͺǤޅ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ++  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~RSQTUVWXY Z [ \ ^_N.J*01F&45D$3%%%%$%E%8c%Q%W%]%9%%4%,%%%<%:Z%T%i%f%`%P%l%;<=>?% %%%O%/@ A!B"C#62L,!K+7H(M-I)G'%ͺ쭧諶ࠢ묦窵  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ,,  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~10^_%%%%$%c%Q%W%]%%%4%,%%%<%Z%T%i%f%`%P%l%% %%%%%ͺ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ϾѮЯ󨷵ǎԐᅠƄ졌 0,5,  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ %%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠ P,U,  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠ p,u,  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   ,,  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %       ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ @@,,  !"#$j&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~""%%%<%$%,%%4%% %%%"H" `abcdefghi@}Q%@@@@@@¢åǨ%  !"#$&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ܡ ``,,  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %`(`'`&`%`$`#`"ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠ +),,  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%@ABCDEFGHIJKLMNOQTW^""!%3210/ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~# 64--  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   %%%%$%c%Q%W%]%%%4%,%%%<%Z%T%i%f%`%P%l%% %%%%%=<;:ͺՑ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~) @>0-5-  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~&     "         !"#$%&'()*+,-./0123456789:?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[FED  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/ IGP-U-  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   & ! 0 `9 Zd}y    "   "!a: [e~zA^{B_=>|T9 CGPXnpbU: DHQYoqcQPONM㥹  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~6 USp-u-  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ S & ! 0 9   R    "   "!Y: Z\[_^VQ!TXUW !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNO\[ZY  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~E _ ]--  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ c  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~= @f@d--  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~A=Z`^dy}{B>[a_ez~|T9 CGPXnpbU: DHQYoqc@l@k@j㡱  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~G `o`m--  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~&$0^4{'%1_5|  l\  !m]`u`t`s  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Q xv--  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~8V(;`"f}W)<a#gJ~K. *EL6rhj/ +FM7sik~}|  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~[ ..  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNO!QRSTUVWXYZ[\^_  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~e 0.5.  !"#$%&'()*+,-./`abcdefghi:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:@ABCDEFGHIJKLMNOPQR0123456789  !"#$%&'()*+,-./:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~o P.U.  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~y p.u.  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~>    !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   ..  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~0^1_    !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ @@..  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~    x !@AVW`atjvukw@@@  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ``..  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ `a}~RSx```  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ..  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%% %%%%%$%,%4%<%%%%%%%%% #%""H"d"e"!#P%Q%R%QS%T%U%V%W%X%Y%Z%[%\%]%^%_%`%a%b%c%d%e%f%g%h%i%j%k%l%N01F45D3E89:;<=>?O@ABC62LK7HMIGJ.&$%/ !"#,+(-)'*  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ //  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%% %%%%%$%,%4%<%%%%%%%%% #%""H"d"e"!#P%Q%R%QTT%VWW%X%Y%Z%[%]%^%_%`%a%c%f%g%h%i%j%l%N01F45D3E89:;<=>?O@ABC62LK7HMIGJ.&$%/ !"#,+(-)'*  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ 0/5/  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ " "!`""d"e""""+""H""& RS      %xD 9 : !   0 1  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ֿ̀ͅع P/U/ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~"!" 0 `"d"e"H"& S      æ˼̾ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~œ p/u/ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./ " "!R`"S"d"e"VTW Y ZX"H""& [ \U       ^_!QO0123456789:;<=>?@ABCDEFGHIJKLMN ݫڀެϴ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   // !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  yz " "!`"#./*d"e"+6""B;<=>9:EFC"DG"& HPQL      %MTUX9 : YVW`  aZ[de}~jknopqrs7{A|"       Ŀ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͅ @ @ // !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~" "!`""d"e""""+""H""& RS      %xD   0 1@@@@@@@@@ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~̀܄ͅާݖֿ ``// !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ " "!`""d"e""""+""H""& RS      %x01^_!   0 `(`'`&`%`$`#`"`!`  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ֿ̀ͅ]>U=*3@<;999>8877@(#)scsi-remote.c 1.16 04/08/24 Copyright 1990,2000-2003 J. Schillingschilyremote-1.16@(#)scsitransp.c 1.91 04/06/17 Copyright 1988,1995,2000-2004 J. Schillingschily0.8Stš֚̚ݚ+2tš֚̚ݚuw[FyzB}}}+~~~~~s``Mm#aBrB}}Lrrs%sSs@(#)scsi-linux-ata.c 1.7 04/06/12 Copyright 2002 J. Schillingschilyscsi-linux-ata.c-1.7@(#)scsi-linux-sg.c 1.83 04/05/20 Copyright 1997 J. Schillingscsi-linux-sg.c-1.83-RH@(#)scsi-linux-pg.c 1.43 04/01/15 Copyright 1997 J. Schillingscsi-linux-pg.c-1.43@(#)scsihack.c 1.43 03/11/28 Copyright 1997,2000,2001 J. Schillingscsihack.c-1.43Z!n!~!!!!!!!!!!" ""----..,.O.i....../+/E/X/n///////00>0T0w00000 1,1\1111112(";"(2??@@@p@@@A8AhAAAAX2222(BPB|BT"2n"""" 33BB(3C4C`CCC"CD DDDlD83"DDDEl33"#4#,EK#f#`E###EE#EF#l+#>A>,/,]>x>>>ll,m`mm>0?\?mn0nhnnu?nno(oL,j,file_write_errK #?*&+?bad_file_opbad_file_modebad_file!qqs*s/ss!qq9"s*s/%s(s0123456789abcdef0123456789ABCDEF(Infinity)(NaN)isoinfo.debugKf.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.gnu_debuglink 44HH !hh' xx/ 7ovv Do88@S xx \  e@@`XX`kQqgwgD$v$@v@\xx||`8  6\ ,ELFp4h4 (444444``x<``HHH Ptd$$Z$Z$$Qtd/lib/ld-linux.so.2GNUC]R#P\D 7TG=%6H:*&'Z9 /!O @(UXEQLWVFB;M,  +1-0"A<?.5)82KNI>SC$4Y3<<+| wjg`? |L'q eZo1%;6W.' 6(z PooX9#H:3kr1X%^Xv]=AQp:MhQ'B5 + 0y:b|'k=@VB<CjoEF3S# [^ U z9,8|gQE 60_Jv_RegisterClasses__gmon_start__libc.so.6putcharstrcpyrcmdioctlsysconfstdoutstrerrorfdopengeteuidgetenv__strtol_internalusleepgetpagesizefgetsmemcpyglobperrorreadlinkputsdup2getuidmallocfflushabort__lxstatstrrchrisinffprintfstrcatsetsockoptstdinwaitferrorstrstrrandsignalreadstrncmpstrncpyrealloc_IO_getcstrtokforkstrncatexeclpgettimeofdaymemsetfcvtseteuidgetpwuidgetpwnamgetservbynamesprintffclosestderrisnanvallocfputcecvt__ctype_b_locglobfreesocketpairfwrite__xstatrewind__errno_location__fxstatsetbufgcvtfopenfilenogetline_IO_stdin_used_exit__libc_start_mainlseek64strchrfcntlsetuidfseeko64fopen64GLIBC_2.3GLIBC_2.1GLIBC_2.0$ii ii ii `[oooJ`````aaa a a a a a a$a(a,a0a4a8aa?a@aAaBaCaDaEaFaGaHaIaKaLbObPbQ bSbTbUbVbW bX$bY(bZ,b\UYE5`%`%`h%`h%`h%`h%`h %ah(%ah0%ah8p% ah@`%ahHP%ahP@%ahX0%ah` % ahh%$ahp%(ahx%,ah%0ah%4ah%8ah%tMD$DD$vr$>!vr1ƅэ\vB)ƒ D$D$r``d`d։PPΉTT $$P v1ЉуDŽ kafkfDŽ avǀrWarnǀring ǀr- hoǀrst_nǀrame ǀrrequǀrestefǀrdrvэ\k1ЉуDŽ /mntƄ vǀrWarnǀring ǀr- moǀrunt ǀrpoinǀrt reǀrquesǀrted]1fDŽ)/1уfDŽ ..D 1fDŽ).~BD$ЃD$$Tblj C/D$D$ D$HT$r$vr1э\vVRQR<0P‰D$TD$ ‰D$r$dvvr1э\v [^_]ãvE1tҋ9tĉT$ vrD$f|$$vv1r򮋅эL v [^_]D$tD$r$Hvfǂr]r1э\vUWVS=rDž\$DžT$L$ $0D$E T$ U$T$0oغQ)R9 CoEoE~ EDž D$ɉT$,  $oDžDžvPD$$rD$vr1э\vL$\$vvǀr Impǀrropeǀrr soǀrrtinfǀrg.ƀr$$^qo\$$D$ =ro&USÃD$$D$$+ $5$H$p$$$UWVSlDžDž]u DžDžt$$\ D$D$QD$T$D$<$D$D$ >sD$Q<$T$t3o)D$$D$ih 1? rClC*C BD$ $T$D$] rË։ D$T$$ko$o`e1[^_]ËJD$Q<$D$(rD$ D$$D$Xiu;.D$h$;D$$,o$6$D$1 D$$D$Z$$e1[^_]D$4$!pD$$D$;^D$D$ D$D$$$]UWVSo]}  ou @EЙ}؅]>e oo9~Ӊؙ}D$ ËE|$ $D$3xo$Ut $iE])DžE[ ^_]É$aD$ Ƹ4$D$T$0!Ѓt0]|$4$ \$S9t $[^_]$USt]nED$ $D$D$fD$D$ D$P\$E$oD$$菃oD$o$趃ox]%D$oo$zoD$<$4t[o@$$oh$t[]뜀} uD$\$$ mt[]áoh$$+Fo$Uouo$É$5ÐUS]$^t{$~1[]É$讌$訑uۉ$Ցt$ȑt $軑uUS]$t$1҃t[]É$?!t1$2 t 1[]É$U u[]É$;t$/uUVSu^@D$D$l$CF$CTC CCCUV$ЈCUFDHu[^]UWVS ]C$$lS$BxC$ [^_]ÉS$1$d;} }\$%yNC@@(uՉ$E$}tuC$~BC$1뗃}:ƒ}0 Шt؃k$ [^_]É$M$茊C$UVSu^@4$x [^]0҃{ 4$tI4$Ȏt$ ?4$Ey4$讎t&4$衎뙉4$y뤉4$UVSu^@D$D$l$CTCCC CCUV$ЈCUFDXu[^]UWV}S1҃<[^_]UWVS u}^@D$D$l$jE {CTCC CVCU$ЈCUCXFDd4$ڐ [^_]UWVS }uE _@D$t$$D$D$l$E sCTCC CWCU$ЈCUCXGDr<$Hx G(u 1҃ [^_]É<$~$z)ƋE t$D$躈UVSu^@D$D$l$-CCT%CC CVCUC[$C\ЈCUFD4$蓏xJAYQ A A AY A  ‰1҃[^]UVS ]u J}Eɴ 5fE m\$mm\$ mm\$m4$D$D$@4$D$D$ [^]UVSu^@D$D$l$CTCC CVCU$ЈCU} C\CWFD4$"[^]UVSu^@D$D$l$<CTCC CVCU$ЈCUE $CXFD4$谍[^]UWVSEu] EE~@ED$D$l<$GTGG GFWU1ۋ]tGXMtWUFDu[^_]UWVS u}^@D$D$l$1E {CTC_C^CC CFD$4$袌 [^_]UWVS }u _@D$D$l$CC CCTGSU…xICVCWuxDECXECYE$ˆSUGD<$ [^_]CVCWuyCXCYE$ˆSUGD<$Nj [^_]UWVS u} ^@D$D$l$CT CCC CCUV$ЈCUCVFDu [^_]@UWVS }u_@D$D$l$`E EC CT CC CW$‰SUCVCWECXGD%<$辊x <$|yU)ƒ [^_]UWVS }u_@D$D$l$E EC CT*CC CCUW$ЈCUCVCWCXCYEC[EC\GD.<$x <$xU)ƒ [^_]UVSEu] =MU[^]UME] u[^] UWVS Eu}X@D$D$l$E ECTCC EC CPCU$ЈCUCVCWCXCYCZC[C\C]E@D7$xE$wU)ƒ [^_]UWVS u} ^@D$D$l$CT CC CV$‰SUCVCWFD@u [^_]]UWVS }u _@D$D$l$}CT+CC CWCU$ЈCUCVCWCXCYGDH} [^_]ևUE U=]E U]WUVSu^@D$D$l$CT5CC CCxSUF‹E tSUFDP4$C[^]UWVSE} uEEEEX@D$D$l$GECT:C<=yl t&X Y'&>$SE[]==='=t&A=t&>$`y=[ &de&>$n)=;='t&-c=0=:t&>us$|$===t&>u3$A  D$$<E[]遧=Xe=Dv=Et&u$ == =u$$$==J$=3$'=&$;=$Jq=Y=$[O$iC$v7$+$$$${$$$$$$+$9$J$Z$i{$uo$c$W$K$?$3$'$$UVS]C$s@$k$1҅x [^]Ã~ F+$UDžDžDžDžDžDžB<D$$D$D$D$ D$D$_t MA<t E@<t UB<t MA<t E@<Eu h$|U0 J<o$D$$ 萙)MAU9/MA<' UD$/$M9UD$9$M9UD$C$՗M9,UD$J$跗M9WUD$Q$虗M9*UD$X${M9UD$`$]M9UD$h$?M9UD$n$!M9vUD$t$M9IUD$$M9E@<ED$$踖U9MA<ED$$苖U9t8ED$$qU9tED$$WU9HMA<09E@<LGvUB<N GADAPG TEC GACB-G4070E@<UD$$迕M9UD$$衕MU9D Bu MA<:ED$$褏U9MA<;MA< EMA<UVSu] \$4$31҅t u[^]É4$US$EE] EttD$ED$D$ED$ D$ED$$1҅ttE E$[]UVSӃމT$D$$肳غ颋.$)T$a^$  )\$C[^]UWVS,}$<t ,[^_]ÍD$D$$胡D$<$vG$Ɖ\$<$vo$t$É<$R.t$谲C< <?$萲$ڌD$CuD$$\D$CuD$$4D$CuD$$ D$CuD$$D$CuD$$輱D$!CuD$$蔱D$2CuD$$lD$DC uD$$DD$WC uD$$D$kCuD$$$ D$CuD$$D$C uD$$蘰D$CuD$$pCt(D$CuD$$BD$P{xD$$D$C@uD$$D$xCuD$$ʯD${xD$$袯D$CuD$$zCt(D$CuD$$LD$C uD$$$D$C@uD$$D$C uD$$ԮD$.CuD$$謮D$HCuD$$脮$ ~D$cCuD$$PC$ @CD$r$bD$D$$CuD$$D$TCuD$$D$CuD$$虭D$CuD$$qD$CuD$$ID$CuD$$!D$ CuD$$$ CfS ¸0CfS ¸CfS ¸{AfSC ¸{C S D$ $ЉD$HC<<CfS1$4s ҉T$;.|$$(FfV$ ډ\$ǫF$$bD$褫غ.$T$舫^$  T$n;g?$<fSCC S D$\$ЉD$D$|CuD$$D$CuD$$ΪD$CuD$$親D$CuD$$~C .D$CCuD$$LD$4CuD$$$D$XCuD$$CD$_$`bD$өCD$w$bD$襩3$CSD$$ЉD$oC*UE]BUW}VgfffS)ˍ )ω)ʍ 4 [)^ ω_]UU)E )EMY… Шt ]Áf]UWVS}j|rk)t؉ )il]𻵁NEE))؍] C1r- S[^_]Í^=ǯwWfk)t؉ )ilf]𻵁NEE))؍f|U 1BB[^_]Uk)tWMVu SN )iǔ))V))N[^_]UVS0]u xB~7E4$D$ED$Et$D$ E$D$0[^]ÍE$D$FED$E\$D$ E$ D$ڦ념UWVSLDžU$}t E$GDžDžt DžD$D$$t DžG$<$荤D$U T$ T$<$D$+1t G<$D$U T$ T$<$D$G(o$uMSօuz~ v\<$\%)$T$D$/G(SօtFt$$<D$.~kvuFD;$?;E U T$UD$D$T$ $WG$tUL1[^_]Ão$1ȋED$$D$O9ED$H$D$뎃o$끋UD$x$T$轑t ~AE$t U$EtfD$D$E$$G$<$̡o$D$U T$ D$E<$D$iG(zEtfD$D$U$跑G$<$_o$D$E D$ D$U<$T$w(]tfD$D$E$JG$<$o$D$U T$ D$E<$D$菽[O(U tbD$D$U $ݐG$<$腠o$D$E D$ D$U <$T$"lG(ucL[^_]ÉED$D$$褏<$!)‰T$E$D$+Z<$!)‰T$U $T$q+q<$!)‰T$E$D$E+<$X!)‰T$U$T$+CUD$L$T$ԎDžED$i$D$誎DžUD$~$T$耎DžXED$$D$VDžqUWVSu]}~UFt#FFFxЈV F F C$$jC$tFC$@|$ $<D$Et$$D$x [^_]ËC$C$$ k$@D$ $<D$Et$$D$袽yK$t 1[^_]ËE D$$D$1ED$t$$?)1U$莂UWS1щ $tyt \$$|[_]U1҉WVS,}tE M EM14tu[ȋU …tE ^1}tU ,[^_]þ$D$@w.uu\$ D$D$$覚J$耂>u6< <  ШuD$ $vG`.^< <  ШuD$ $~v.^< <  ШuD$ $/v.S^< <  ШuD$ $u "u C"uCu.U DM$!u $,.EDžTDžP$8u$D$tD$E$ԉV$a>uD$ D$ D$$vD$k$qD$ $gtD$ $HtD$ $)tu$5t$cD$ $s.D$ D$ D$$u$D$,SD$$B:UWV1S1҃t<[^_]À?uEU<[^_]ÍE<$D$DŽtڀp€P Шt.E1EU*€x Шu$t딀t€T ШtSE1뾃9EȋEUeȉU܋UE؋]܋EUE̋MÉM]܋]܉]5g€G ШtEUSm€M ШtEU/f€F Шt0 iM0 eUs€S ШtEU k€K ШtEU b€B ШtEU w€W ШEUqUVSU EEËE ։ؙ1؉1 u E [^]É\$t$ D$$薅EE [^]UEUEyM QEUb]U(E D$D$$D$D$D$ D$!D$-x1Ut3@ ~,D$$7quË btU1]UWV1SEUE} EEPh~59~\$ދED$$誓UBh)9}&)D$ED$E$~~9|ڃ[^_]ËUE[^_]UWV1S,}2)=}Í\$$ 9|ʁ,[^_]UWVSUEƉEE E9u5_hx2P> tN9uwɋU[^_]AEt+F ~ED$3$D$kYČ[^_]ÍUD$P$FED$P$rUD$ D$ D$$eo~+VtugE1D$$*E$F ~(UED$MT$D$ UE$D$蟁mU)=~-E눉c0UWVSEEEE E1}эYm\$E4$D${9t EEEE[^_]UWVSl}Wht8E uD$ D$jD$P4$諏ډt$$ Al[^_]UMQhtD$o$r UMQhtD$z$}UWVS,E] uHh1ɋ} u'1 u1 u~,[^_]Ë.x㋁tى\$ |$t$D$D$D$$膎E\$$U1WVS}] Ohڅ u~ 1[^_]Ë1\$ H$D$D$D$\$$[^_]US]Clu$ChCltx u[]É$m҉D$$>[]U1WVS}Wh2E ]D$ D$D$P$N\$$EPWh]9E|r9]E E $mGlČ[^_]D$\$ D$D$4$jE-E=‹Wh9.wO ~D$D$$|}WhEGD$\$ D$D$4$jyfE-E=ƋWh9. W .D$D$$|<$Č1[^_]ËE맋E%UWVSl}Wht8E uD$ D$D$P4$艋ډt$$l[^_]UWVS }Wht4u}u\2x u 1 [^_]ÉD$$ËGhǀ4$gGh [^_]É$jWhǂ덉$jWhǂi$jWhǂEUWVS]|EE$D$D$ D$P\E\$$Ɖ$g1tEt$$؃|[^_]U1VSuM ^ht t v 1[^]$8tAta΋t6뼸c뵸Fc뮸Mc막$^h릉$^h뱉$^hUSd]$D$P$D$ D$ D$gd[]UWVS|}Wh_@G,CDžD$DžCD$C D$CD$CD$D$@D$ $興ƋC D$D$CT$轈s CHet$D$$s9t +~3D$D$$s;t $ƅC)CaC QC$AC(1 CLCL~-D$C+$$F1C>tt$$~1|[^_]ËC.=@D$D$$#Dž^1C 됃 CL "UWVSDžUEr,@z Zƒ Шd[u^hM u D$:E $gbE pE hu D$D$t$ $ʅD$:$#b|t |D$ $ ybo߅D$@$a)=v\$D$ D$!D$$~/tE@ ~-|$otT$ D$8$D$v$-ap`$&aeuoۉl0]4$Od)D$D$D$ $d!aZ$`D$$btD$$b$*!u$dIauFtu!Ĭ[^_]$dYuL\$|$D$D$T$ $腃볋UBttD$8D$$a$`‰Fh1.xBǂǂǂǂǂǂǂ$_$cׅnUBh8B b|oD$ D$UD$P$\$$ZExgE hEEËE\$D$ ht$E$_UBhDžǀĬ[^_]D$_$c^o`$_o3D$$r$irotIDžpt$D$$\rxDžlD$$lrB$]`W9t$a_a9tG$]]p$v`D$pD$otT$ D$o@D$$1`uFtsD$wD$$t$Kq%GD$$D$+qD$$\D$$\D$$\lD$/$ _tXD$pt$tD$ D$\$D$l$]lt$$wpQ$@UUM tM UH]ct~`ct1]øcUWVSE@dE ]@dtu t=U $T$UR xCD$ C D$C$D$a\[^_].tE볋EUE]JUVS] u\$4$P9É ШtˉNT^X[^]UVS] u~\$4$9} 1[^]Ë\$4$PFp[^]US]$PCp[]UE]J UE]J(UE]J,UE]J0UU EPd]US$]E$D$@|hD$ $etaD$$\t $[]D$l$;uD$$'uD$p$1҅t$\UEP@B uJ$uz(u1z+t]UE]@@@UE@@Px@])Ë@]UWVSEEuX@C(D$tt$D$ E $H|xe} )ǀ{(xi{)C(vLC(f%f=ET$ D$D$t$<${x+U [^_]$C)D$|t$D$ <${.x)ƀ{)pC*D$|t$D$ <${.x)DE[?5+(! UWVSE] uD$ D$\$E$zxV}(UD$ UD$\$<$zx3)ÃyD$\$<$zx+U[^_]Ã[^_]UED$ D$ED$ E D$E$3UWVSE}u X@C~Ct +E [^_]ÉD$CD$H|$D$ 4$z….xҋu C)փd~dD$D$|$D$ 4$….xUE@@P TD$&D$ ET$D$E $kɉ!U,WVS|ElEux@G t:<t*]D$ D$HD$@$yڋMADt8tEEM T$D$D$ Rt$L$G$$Sx9] )ËEt$\$$x)ƃ G(u+U |[^_]ËGLt$$D$ G+ED$.x)ƍG(D$MED$L$ t$\$$W.x땅hGMbD$EH`Y؍])‰T$D$D$@D$ $wMt$\$ $J.)U1҉WVS,}]G(~oG@@D$GD$G D$GD$GDD$\$D$ E $awx,u )É<$Ɖ\$t$x)Ã(+U ,[^_]É\$t$<$.xƉ+U US]K|+St$L$)ЉD$&C|[]UWVSEu X@$NjC~Cu +E [^_]ÉD$C|$|$ D$ED$D$4$sv….xNju )Uփd~dD$D$q4$D$ ED$….xUMbWVS}uG@@D$O`Y)‰T$D$,t$D$ E $ux] )Ã(+U [^_]Ét$\$<$.xUWVS}]<$M tE 0t2G$~W(t'E<$D$ED$xq])EËG$~G(t7G@xt+|g@D$$D$ ED$ux,)EG(~*E\$<$D$xÉ+U[^_]ÅyG$ɋED$$D$t.x)EG@nUWVS]Es${(C$C(D$ E $D$D$s${([^_]UVSEu D$\$$~D$\$4$\4$P[^]UU$D$US]K|+St$L$)ЉD$ ED$ C|E[]US]$][]UVS]D$t$$~$D$t$$[$%P[^]UWVS }u]E D$D$D$D$<$DryE } [^_])rUED$ E D$ED$o$UVS EX@$ƋC~Cu [^]ÉD$Ct$ t$D$oD$$qd~dD$$qD$` [^]UMbVS ]C@@D$K`q)‰T$ D$,D$o$5q{( [^]]$ [^]\USEX@C~Ct[]ÉD$ CD$HD$o$pCd~dD$$D$[]UE@@P T$&T$D$YUWVS }E u]D$D$<$Wpx'B^w/T$D$%<$0pyE } [^_]pD$<$pUED$ E D$ED$o$[UWVSE] uD$ D$\$E$MpxX}T$ D$%\$<$*px5)Ãx8EEB^vD$\$<$oyˉƒ[^_]D$\$<$o.xۍ+U[^_]UED$ D$ E D$E$qUE D$ED$o$UE]@@@(UVSEX@$n1҅tC+$F$.LF >1e>F$uF #F UEU tdt~dt1]øeU(E D$D$$D$D$ D$ D$D$1K1UWVSEPhEEEB EE}Ph17DZx$BEPhfDZ~׃E}~ȃEm老}~>t"$EUBhǀǀ1[^_]UWVhS]t$$\$Cux%=`t 1ļ[^_]Ét$\$$Cux%=XD$\$$ Ey E1󫍅XD$$EEt4D$$DDt t~ڃt&t-Uȅt&duBeu BvuB\D$$=UD$8$)UD$h$UD$$UXD$$D$?@=ƄXf1WX/I߹򮍽XʹэL $A \$$ID򮋅р|/D$/$pB@X|$$AD$PD$$B|$1$C1tI.u B.uBuDŽ~ DŽ uDžt1t1򮋽tэ<9t~Ջtu Džtt=x91ƅH t1HfDŽ)G/D$H$@벉|$$A1uӃ $>AB=7HXƄHL$<$B&X\$D$|$ $H` U̹|ֿt,|iuBdu BeuBED$ D$ D$$>D$ D$ D$1)ЉEԃ$>D$ D$ D$1)ЉE؃$>D$ D$ D$1)ЉE܃$^>M̙|1)ЉiuAdu AeuAt(|(׃B()1ɋph =N $<t%9uN!;u;u~pD$D$$PD$EЅu1||\$ D$D$D$Op.dJhf|AT$t$ L$\$D$l$^O L$D$ẺT$L$ D$D$Bt$\XT$\$D$ D$$NT$ \$D$Hu fDžH/$=xPfTAq $Јq Qhr!r $Ȉr E 0EE  T$$T$D$ẺL$(t$ t$L$T$ D$D$L$\{||HQ҉:Dž(‰(‰҉Xщ $9.XD$$=|sD$S1D$$;tB ~*D$D$ D$$ZD$SD$ $e;#̉@ 򉍀~BL$T$t$L$ D$D$$;Z򉅌ǹ򮋅DM|\$ |$f/LADžUWVSEU@R EEUX@,E}ƒ} Шu~)47UBtFČ[^_]ËExhou tu t$U :}1}ED$D$D$ $r5UD$D$$T$ $*O5EE%KE$D$ ED$ED$EMEEEUD$$48Ex ~5U|$ \$D$D$$Wa] tu ttEx ^M t E 8Ed$IUB,$DI$IE$6EE 놐t&#5ttt Ex v4Ƌ >u\$D$U$VD$|$ \$D$ U$Vo<$3b$ 4UƉBh1.Ydždždždž fdždždž1E~ 1ۋEMph1ҍfDF~~m~U\$D$DT$UD$T$ $GVD$$;xtED$ ED$ED$E $EEUD$ E$D$ED$3EE!D$7$UUBt>tU D$TD$T$ $U1Uz >~"D$|$ \$D$t$TU$Y4UBtD$$TvU]U1VSU w5EXh1t)11ҍf|Cy~~1[^][^]U1VSM ]u u71 u&!EPhtDB[^][^]UD$E@t$4SUEP@hP $t1҅‰]U1U tBwE SU]4]UWVSuF^@x{ ~C C$1ҁČ[^_]ÍExD$D$,$eED$D$@<$MECCDECtEC 1҅~DTD9S CEȋEċC@ƅ8iCD$S}ЉE܍ED$F$3 Ct43M9t+EȋS9vЉD$L$4$1EȋS9v)ЉCC xC(CE$EtCLxC+|C/EC3EC7EC;EC?ECCEC(CGE@tuC C( u,C$tb.+ƒ  к. PC$~ |$D$$PUЀ:uztC$UWVSU] t3rht0Rx9t%et~A ett;1[^_]Ãd.t~eu߃[^_]øe^e䋶 .xQ)ڍRȹhЉ)‰T$ )ډi'U)É؉)L$ED$vD$D$ $oyPo9US$] D$D$$D$D$ D$ D$D$5$D$D$D$D$ D$ D$,D$4E\$$=$D$D$D$D$ D$ D$XD$w4$[1]UWVSÃLUUu}xDЋM)‹E UttL[^_]ÍEMD$SD$ $/1҅u֋C ~$ED$D$ ED$$CNED$SD$E$.ẺUԉMЉE؁{ U~0D$EԉT$D$ EL$D$D$$MEUM EԋUЉMtE܉.U؉EgUWVSEPhEEE9tLfDŽBE}17DZx$s*EPhfDZ~׃E}~ȃEm䀁}~>t"$}-EPhǂǂtXxNfDŽBE17DZx$)EPhfDZ~׃E}~1[^_]USÃD$$,$D$D$+[]UWVS<}Gh NBE EEEE1kUt$ T$U<$T$P$.x׍EED$r"D$$M,.xE9E~ED$u"D$$&,~E}{E}cE ;EEEE1kUt$ T$U<$T$P$.x׍EED$r"D$$+.xE9E~ED$u"D$$s+~E}{E}cEE1Ut$ T$U<$T$P$xcED$r"$D$+xH_ ~6EUt$D$ET$ D$ED$D$$JE;E}EqE}aE}I]Gh>yt6xW;t x ؃<[^_]ËU 9|U t&UWVS u} F ~|$D$$\I'Í8$*1tFhVlډЃ [^_]US]Clu Cl[]É$)Cl[]U1VSU w5EXh1t)11ҍf|Cy~~1[^][^]U1VSM ]u u71 u&!EPhtDB[^][^]U]US]Sh9CtAu3ED$"ED$C$(x 1Ƀ}[]UWVSLE] PhpE9PtBE}D$"|$4$6(x1҅ttstKL[^_]ÍU1ׅEPEZttLM%ƒL[^_]E|$D$"4$'1҅yEt&׉T$D$4$$USÃU$f%‰U҉Ut ЉEED$"$D$C'x[]$8[]UWVSP4|$D$$%%x%=`D$<$%D$D$<$%XD$D$$$1V8Dž\$ CXD$<$D$'t!# vtt  tD$<$D$:%[^_]UWVSLUE@h GxG xwxEEU؉D$ED$ED$ ED$ED$E܉$Mu MMw~Whrf f9tD$$[6u܉؃E>u~_ ƉE܅~rEt$D$D$ $nDu܁vN1L[^_]1ҋ_h9t%SfufSЃE.twU.xEE.xMȋ_hЍf|CEYMԅ-;uMȍfDCE؉$ ?frmǀ ED$"D$$$.*Ghu G,QD$0)ڍRȹhЉ)‰T$ )ډi'U)øQ؉)L$ MЉ$L$B;U  E;EU؉=GhU؉G1{U؉Gh'U؉MfLCUWVSDžPDžLUBJ Z=X\ƒ` Шu~+! MQtn[^_]ËE tUE tKqÃAuU BTu BAuBuDžLE MAhL`} tM 9uwX1\u]L1P1ۅ1P~ UBttPP~ UBttE M 91DžT} M D$ $'=7TډD$`D$D$\D$ D$X$El`UD$ \$D$XD$`D$\TD$Xډ$EL$ rEDžDpPx Hƒ Шu H"MAt>t*H|$t$ T$D$D$$@PEX DžTDž<UT1ۋBhHL$D$D$ $?<1EPh7DBft0Tt$D$\$ T$D$M$>~~TtM D$TD$L$ $>13u `U BaTGDžT8MD$D$L$ $ED$D$$D$ $E1..D$4$x{`ډD$\D$ D$X$E.\Xy`PE.4tUBt>tD$D$$=.t.ttMAt>tt$ D$TD$$@=E$>WEHh1f fAyUB ~&D$(D$$6<EHh>y ǁE t U :1 _HQ19`U|$ D$4$D$ N<MD$ $EHPh>f\B$ 1ۉEɉHh.O1Lǁǁǁǁ fǁfǁǁDžT1T1fDŽQ12fDA~~ჅTT~`D$D$D$\$D$XD$ ;WUB,>tD$T$9:ME dD$ $dED$D$D$ $*E1D$4$dD$"$D$S7FڃaD$ `D$\D$X$Em\Xy`PEt 4OM $UBt>tD$|D$$9$;뮋UBt>tD$>D$$m9.z.p.f ])hDžHD$D$ D$$U3hD$T$ D$$$b lDž@tƍFD$ D$ D$$ D$4$SEDPhf\Bl@t @4uh $2D~ UBtt} hM 9\H1.D$ $s1} U Dx1 MAhHf\PL$ |$D$E$DDTUMBtu1@UBttM L$ D$TD$$$7΋MAt>tD$tD$$6c..UBt>tt$ D$TD$$6h $KDU$fUWVS4Dž@4Džr@0~ 4Yh9AV4;P4t04Zh;,(4@ ~)FD$ D$D$4$5V~l4YhtV,(;~4 [^_]ÉЃ$)(V$,_$FDž $$$$ D$D$$,$&,$  Q4AhQ,H61D2T,D $9|Fu),T8$9tFT$D$$4~_$\$,T$0 $9t!\$ D$4BD$D$X%4Ah9,@ D$T$0 $OFt",$;tFD$$D$4,B F F$z pFF)$F,x4B(~FB ~?,AD$A D$AD$AD$ D$D$$24P49Vt 01[^_]Í$F,xbF+N(FLD$D$,$3V$,F$ F F$yHAX<$4X ‹@XD$ BhD$D$$14Yhw.F(8D$D$l$#F+8FDž@<DžHDžDƅVU$ЉڈF4x F+TFLTD$$(D$,$1(,NDž 4$|~!4A`9|Mt@F H4B`uF(F$F "4Xh9H}F$F 4P40UWVSlEE]Cs@xChf~'l[^_]F F$1l[^_]Í}D$D$@<$!ESF>EF EFEFEEFTEF+EiFMEĉ|$D$"C$NjC ~|$D$$.iEԈF(E׉FLK ~&EډD$ ED$PD$$.E؃vFE E$eC`U9}LF$F F tF$uF$E܉F1E1~EF 볉$~~C`uF(F 독ZEtV$uF$~+i~(_FLuFL~-~7u{~8uuF(F+FL'?,F$ƒ Шt ChfxCN$ƒ Шu RxxF(fǀGUEU tdt~et1]ø#fU$ 1U1]UD$x${UD$$ZUY UA 1U, 1U]U1]U]U]U1]U U ÐUU EP4]US]C\uEC`uMC@uUu]ueChum$0Ctuu][] $ C`t$ C@t$ t$ t$ Cht$ $軭Ctt$ ][]w US$ 1҅D$D$$cD$ D$D$$CC4CL$C\$C`tp$lC@t]$lCttJCxC|o$$Et $/څt[]É$1[]US]$$1[]UVSut5@d$t$$P趕t$$P$1[^]UWVS\DžDžE DžDžDžtE UP EC,Eƅt U:9t5oD$$(D$ D$D$$M1}U~4CD$C D$CT$D$D$ o$($D$赩څ\[^_]ÉuquVD$:$ u7+u~t$U$T$$Ƅ5G<@D$,$W.1DžDžDžDžDžDž1:c]1ҁ\[^_]ËUoD$T$$"&uRCD$C D$ CD$$D$o$%D$ D$D$TD$D$o$%덋BDžDžDžD$D$D$ D$E$D$UEB<(<: ШtSD$:E$t6D$:$. Uƅ D$U$T$oEDžDžD$,$l@E .D$UT$E $$1E t Ct$R1<,iD$4$S8EE .kt$ D$!ED$U $;$1H} t8D$D$D$DD$ UT$E $#$D$8,E .tыD$tD$ UT$E $#B瀽DžDžD$E$D$\ED$ D$UT$E $"A9. $D$0,„ Шt8t1G $D$]8u-(} .sD$D$ u .PD$<D$ zUWVS]u }uUCs{ S[^_]ËE|$t$$D$ R$UsC{ S[^_]ÐUWVSME] ɋ}1t9tdug~݃@MpU1u"9\$ D$ED$<$9![^_]B;EuB[^_]É\$ D$UT$Ńg.UEwNfAED$PSD$ ËED$xSD$ 벋ED$SD$ =f.gUWVSEEEEEDž|DžxDžtDžpDžlDžhDždEu $tMnD$)ЍR@$D$tE=n5n$S[^_]Ã[^_]Ív$D$lj\$$D$ |$$vUS]$>;n})@nt9 @t9u@[]Ã[]1UVSu4$;n}Sn[t9 Rt92utE 2B[^]$ .tCBSӉNUVSu] 4$u É] [^]^Uo$ÐUWVS }vu$4$>E |$D$E$(xσ [^_]UWVSEu} uE t:E)Dž~/t$|$E$}Et[^_]ËE[^_]ËE$UEEED$ED$E $1Ʌt;ED$D$E$1ɅxET$$D$ÐUW1VSE] €  Шu+-Uu0E t"A< w30;E}} uދEtߋE 8[^_]ÍAq<< Ш.tω<w7W뤃 qE _E x€X ШSE cU E D$D$E$U ED$E$MU ÐUWVS$EE}E €  Шu+-Uu0E EE؉ULp;u}uE]ue]܉щEЉً]]EЉUEMԋUUt4A< vAY<€ Шtpvp;u|Et ]U]E UMH$[^_]Ã!EEx€X ШEU E D$D$E$mÐU$ ¸tEBE Brr1USr]tB$D$Rr£ru$UWVS u"$4$$… 1Ҩu [^_]UWVSÃL!xN4$tbU T$UD$|$T$ $hUu L[^_]É4$L[^_]ËE D$ U|$$sUT$Eȉt$ D$zUD$$EwUEUD$E $16US]  U\$$1[]UEUD$E $US] U\$$¸[]UE D$pUD$ ED$o$ ÐUVSM EUxt y؉ É ÉЉу‰~?yӃ~ [^]È[^]ÐU<,„ кtÉL$$UɉUVSyAu_€- Шu1=[^]UWVS\E] :<-<-<+t{DžDžDžuIUDžE ?-M}tM EPB< Ȩt DžU -\t:$nD$t& +1;tK빃: uv{uF<, ШtыE<+=1tu1;u<&tV,1t7&1}t ,1uɋu;t *H?$U{t&,1t7&1}t ,1uɋEM <VB< ȃEP;.G;u.=~,v0Nl€L Ш$Fu+&1}t ,1uɄtEt u1;}|;}`^y>t߀,„ ШuȀi€I Шul€L ШF;|DŽfDŽYƄw-+!E1.M Dž;-bDž{K\[^_]À~ ;Qvs€S Шt Ffc€C Шt FlVB< ȨD$$(.1;.;.8ZuF<+t+BxFWN,„ ШtAi뷀l€L ШtNFt$$&؃[^_]D$ D$D$$tD$$N뭉oD$E $xu1늋E $1xUWVSEUB:EEBX~EUJuR$xM4$L$׃yED$E$׋UBtM$ L$׃yE[^_]USӋR ȃ@ouS []USӋR ȃ@ouS []USӋR ȃQouS []UWV}S_ 1҃@oɈu_ [^_]UWVSEEB}EU1FуMV,M~ E+}~}t,~$ t&V(:tED$$V(UV(:uFuF$x؋U$T$UyF,t~$ tsE>E$0D$UmyUtMEL$$UUu^tM$ L$UyE[^_]ËV(:.tML$$V(UV(:uaF9)ȉEvUVSø,Wt1N؅x&ȋVx t  yF[^]CUWVS DžDžEU uDž%M $L$U<%u׍ƅ1҉DžDž DžDžà w$\WĜ [^_]À*DžӃDBЉC< v݀.Dž$;W|$ U$AW|$|$$$EW‰D$BCwC$W0EEۉM9MɉUtE܉EEEUMHEU0^_É;}vUM̉UMEUEU0^_ǃEua9}w9urŰE)E܉ŰUtE܋ỦEUMEUQ녅u 1ƋẺE܉U= +EԉE؉MMM׊M؋U E̊ME̊M؋E ẺE̊MUe;ỦEw uE9Ev M)MȋEM̋E+EщM̉ʊMMԉE ‹EUEUWVS [Ú޺ E)19s׉M)F9Ήr [^_ÉUWVS[I ) pNu. [^_ÐUSR`` vЋuX[US[P访Y[ RRlen=%d %c%cPXPNSLNMCLPLRETF=%x=%s=[%x,%x,%d]**BAD SUSP %d %d]Flag %x != %x**BAD RRVERSION (%d) %3d %5x %8d File name length=(%d)Volume sequence number=(%d) %llx: %sInterleave=(%d) File unit size=(%d) Flags=(%x) [%d %d] Usage: %s [options] image Options: -help, -h Print this help help,h,version,i*,dev*ISO-9660 image not specified rbCannot open '%s' Bad Argument: '%s' No errors foundBad Option: '%s' linux-gnui6862.01isovfy %s (%s-%s-%s) Incorrect length in symlink component********Directory has unusual size -version Print version info and exit -i filename Filename to read ISO-9660 image from dev=target SCSI target to use as CD/DVD-Recorder If neither -i nor dev= are speficied, is needed. Root at extent %llx, %d bytes Only one of -i or dev= allowed gF!Read error on old image Seek error on old image . %s%sCannot open SCSI driver. Cannot get SCSI I/O buffer. test unit readyrezero unitrequest_senseinquiryInquiry Data :read capacitySectorsize: %ld Bytes medium load/unloadprevent/allow medium removalstart/stop unitset streamingscsi_set_streamingset cd speedqic 02write_g0write_g1write_g5seek_g0seek_g1flush cacheread bufferwrite_bufferread subchannelread tocread headerread disk inforead track inforeserve trackreserve_track_rzoneread dvd structuresend opcclose track/sessionread master cuesend_cue_sheetread buffer capBFree: %ld K BSize: %ld K blank unitscsi_format: preparingformat unitscsi_format: running- [unable to fork()]mode sense g1Mode Sense Datamode sense g0Mode Sense Data (converted)SaveSet %s Mode Parametersmode select g1mode select g0Cannot read TOC header CD-Text len: %d wctbcdtext.datCannot read CD-Text header Cannot read CD-Text Cannot read TOC TOC data: ENT: B0 lout: %ld B0: B0 start: %ld tocheader: Session info too big. Pages: 0x%X Density: 0x%X Blocks: %ld Blocklen:%ld read_g1capacity_not_setread_g0Device type : Version : %d Response Format: %d Vendor_info : '%.8s' Identifikation : '%.16s' Revision : '%.4s' Capabilities : SOFTRESET CMDQUE LINKED SYNC WBUS16 WBUS32 RELADR TERMIOP AENC Device seems to be: Adaptec 4010Kodak PCD-600Sysgen SC4000Matsushita CW-7501Generic mmc2 DVD-R/DVD-RWGeneric mmc CD-ROMMissing Entry for dev %dPioneer DVD-R S101Plasmon RF-4100Emulex MD23Sony CDU-924SGeneric mmc2 DVD-ROMPhilips old CDD-521Ricoh RO-1420CPhilips CDD-2600Sony SMO-C501Adaptec 5500Generic NON CCS DiskAdaptec 4000Adaptec 4070Philips CDD-2000Maxtor RXT800SMatsushita CW-7502unknownBerthold HR-ScannerRicoh RO-1060CAdaptec 4000/4010/4070Generic CCS DiskAdaptec 4520AGeneric mmc CD-RPhilips CDD-521Yamaha CDR-100Emulex MT02Adaptec 4525Emulex MD21Microtek MS300APhilips CDD-522Yamaha CDR-400Pioneer DW-S114XGeneric mmc CD-RWGeneric CD-ROMTeac CD-R50ScaddythisTry to load media by hand. CD capabilitiesInquiry Data : RXT-800SACERCREATIVEGRUNDIGJVCMITSBISHMITSUMIOPTIMAPHILIPSIMSKODAKHPPINNACLEPIONEERPLASMONPLEXTORRICOHSAFSANYOSONYTEACTRAXDATATraxdataT.YUDENWPIYAMAHAMATSHITACDS615EBERTHOLDEMULEXADAPTECCR-4020CCDR2000CDD521/00CDD521/02CDD521CDD522PCD225KHSW/OBCDR-240CDD20CDD26C4324/C4325CD-Writer 6020CDR100IPWXR-W2001XR-W2010R2626CD-R 650ACB-4520ACB-4525RCD-1000RCD5020RCD5040RCD 4X4CD-WO DW-S114XCD-WO DR-R504XDVD-R DVR-S101RF4100CDR4220CD-R PX-R24CSRO1060CCD-R2004CD-R2006 CD-R2006PLUSCD-RW226CD-R4012CD-R CDU92CD-R CDU94CDR4120CD-R55SCD-WO CRD-R24SCD-WO EW-50CDR10CDR200CDR400CDR-632PCD-R CW-7501CD-R CW-7502 %s: %5d kB/s (CD %3ux, DVD %2ux) 32162424 (I2S)traypop-upreserved(3)disc changercartridge changerreserved(6)reserved(7)CLV/PCAVreserved(2) Drive capabilities, per MMC page 2A: read CD-R medianot Does %s%s write CD-R mediaread CD-RW mediawrite CD-RW mediaread DVD-ROM mediaread DVD-R mediawrite DVD-R mediaread DVD-RAM mediawrite DVD-RAM mediasupport test writingread Mode 2 Form 1 blocksread Mode 2 Form 2 blocksread digital audio blocksread multi-session CDsread CD bar coderead R-W subcode informationreturn CD ISRC informationsupport C2 error pointersdeliver composite A/V dataplay audio CDsLoading mechanism type %s: %s Is %s%s support changing side of diskMaximum read speedCurrent read speedMaximum write speedCurrent write speedBuffer size in KB %s: %d Write speed # %d: MMC-2send digital data LSB-firstLength of data in BCLKsRotational control selected MMC-3Capacity: %ld Blocks = %ld kBytes = %ld MBytes = %ld prMB scsi_format: post processing %d Formating in progress: 0.00 %% done. Formating in progress: %.2f %% done [%d]. Formating in progress: 100.00 %% done. Mode Parameters (un-converted)Cannot load media with %s drive! error: %d scb.chk: %d sense_count: %d sense.code: 0x%x restart non-streamed digital audio reads accuratelysupport Buffer-Underrun-Free recordingread fixed-packet CD media using Method 2return R-W subcode de-interleaved and error-correctedread raw P-W subcode data from lead inreturn CD media catalog numbersupport ejection of CD via START/STOP commandlock media on power up via prevent jumperallow media to be locked in the drive via PREVENT/ALLOW commandcurrently in a media-locked statehave load-empty-slot-in-changer featuresupport Individual Disk Present feature Number of supported write speeds: %d Number of volume control levelssupport individual volume control setting for each channelsupport independent mute setting for each channelsupport digital output on port 1support digital output on port 2set LRCK high for left-channel datahave valid data on falling edge of clockCopy management revision supported:zD7Mb?<  ATIP start of lead out: %ld (%02d:%02d/%02d) ATIP start of lead in: %ld (%02d:%02d/%02d) Mode Page DataCannot get default %s data. Cannot get %s mask. Cannot get %s data. Cannot get saved %s data. Mode Select DataWarning: controller returns wrong page %X for %s page (%X). Warning: controller creates hard SCSI failure when retrieving %s page. Warning: controller does not support %s page. Warning: controller returns zero sized %s page. Warning: controller returns wrong size for %s page. Warning: using default %s data. /etc/cdrecord.conf,:/@%s=CDR_DEVICECDR_DEVICE=CDR_FIFOSIZEBad fifo size environment. CDR_SPEEDBad speed environment. CDR_SPEED=CDR_FIFOSIZE=Bad fifo size in defaults. Value %lld is too large for data type 'long'. REMOTE:rscsi@host:1,2,0rscsi@host:bus,target,lunREMOTE:Remote SCSIRSCSIProtocol error (got %s). Remote status(%s): %d '%s'. R%d A isatapiI initiator idT%d %d %d %d filenoB%d %d havebusF freebufM%ld getbufsndsize: %d rcvsize: %d D%ld maxdmacloseV%d versionS%d %d %d %d %d sendcmdREMOTE%.*sRSHdup2 failed. Illegal remote device syntaxO%s opentcpshellCannot create socketpair. /opt/schily/sbin/rscsiUnknown user: %s rshshell/tcp: unknown service setuid(%lld) failed. seteuid(%lld) failed. -lexeclp '%s' failed. Lost connection to remote host ?? locuser: '%s' rscsiuser: '%s' host: '%s' Warning: Using remote SCSI interface. Illegal value for busno, target or lun '%d,%d,%d'who are you? No passwd entry found. Cannot get connection to remote hostrcmdsh: fork to lose parent failed. ***W*W*W*W*W*W*W**y*g*yesYESstatus: 0x%x Reserved(%s%s) host adapter detected errorBUSYINTERMEDIATE GOOD STATUSRESERVATION CONFLICTCHECK CONDITIONCONDITION MET/GOOD %02XSense Bytes:Write Data: CDB: retryable errorfatal errorerror: %d%s: scsi sendcmd: %s no errorReceived Data: resid: %d DMA overrun, vendor specific %d unknown device type 0x%xRemovable not present unsupported reserved unsupported TapeWORMProcessorPrinterunit not presentWell known lunAutomation/Drive InterfaceObject based storageBridging expanderOptical card r/wSimple direct accessEnclosure servicesStorage arrayIT8 2IT8 1CommunicationJuke BoxOptical Storageunknown/no deviceSCSI ALREADY RUNNING !!INTERMEDIATE CONDITION MET/GOODSending %d (0x%X) bytes of data. SCSI command name not set by callercmd timeout after %ld.%03ld (%d) s Executing '%s' command on Bus %d Target %d, Lun %d timeout %ds Got %d (0x%X), expecting %d (0x%X) bytes of data. cmd finished after %ld.%03lds timeout %ds Cannot send SCSI cmd via ioctl ret < 0 errno: %d ux_errno: %d error: %d Currently running '%s' command. 808908(90808088080808080808089080808 90808089FF GGFFGGGGGGGGvGiG\GOGEGFFFFFFFFFFFFFFFFFFFFFF;GGscgo_send(%s) wrote %d bytes (expected %d). DMA (read) overrun by %d bytes (requested %d bytes). ATA Packet specific SCSI transportEXAMPLE: /dev/scsi/host1/bus2/target3/lun4/cd EXAMPLE: /dev/ide/host0/bus0/target1/lun0/cd EXAMPLE: /dev/hda or /dev/sr0 ERROR: in scgo_get_first_free_shillybus(...). Too many CDROMs, more than %iIncrease MAX_SCHILLY_HOSTS in scsi-linux-ata.c and recompile!ERROR: unknow subsystem (%s) in (%s) ERROR: this cdrom is already mapped %s(%d,%d,%d) INFO: subsystem %s: h %i, b %i, t %i, l %iERROR: with link merging! base %s link %s, result of merging %i ERROR: with link reading! link %s, result of readlink %i INFO: /dev/%s, (host%d/bus%d/target%d/lun%d) will be mapped on the schilly bus No %d (%d,%d,%d) INFO: Bus: %d Target: %d Lun: %d Chan: %d Ino: %d try open(%s) return %i errno %i calling sg_mapdev(...) Warning: Using ATA Packet interface. Warning: The related Linux kernel interface code seems to be unmaintained. Warning: There is absolutely NO DMA, operations thus are slow. errno (EACCESS), you don't have the needed rights for %s try open(%s) return %i, errno %i, trying next cdrom Illegal value for bus, target or lun '%d,%d,%d'try open(%s) return %i, errno %i, cancel INFO: scan_internal(...) failedNOT IMPELEMENTED: scgo_initiator_idioctl(CDROM_SEND_PACKET) ret: %d Generic transport independent SCSISCSI transport for ATAPI over Parallel PortATA Packet specific SCSI transport using sg interfaceBus: %d Target: %d Lun: %d Chan: %d Ino: %d Target (%d,%d,%d): DMA max %d old max: %ld Warning Linux Bus mapping botch. SCSI Bus: %d (mapped from %d) Linux sg driver version: %d.%d.%d Use of ATA is preferred over ATAPI. SCSI unsupported with '/dev/hd*'DMA addr: 0x%8.8lX size: %d - using copy buffer pack_len: %d, reply_len: %d pack_id: %d result: %d sense[0]: %02X Allocated DMA copy buffer, addr: 0x%8.8lX size: %ld host_status: %02X driver_status: %02X No remote SCSI transport available. Can't do %d byte command. ATAPI:1,2,0ATAPI:/ERROR: unknow format INFO: %s -> %s srINFO: l1: 0x%lX l2: 0x%lX ATAPI/dev/cdroms/cdrom*/dev/hd[a-z]INFO: do scgo_open openbydevCannot open '%s'schily - Red Hat%d.%d.%dsgpgATA:scgo_getbuf: %ld bytes Cannot set SG_SET_TIMEOUT. Bus: %d cookie: %X file (%d,%d,%d): %d /dev/hd/dev/scd[0-9]/dev/scd[0-9][0-9]Cannot open '/dev/scd*'PP Bus: %d /dev/pg%dCannot open '/dev/hd*'/dev/pg[0-9]/dev/pg[0-9][0-9]Cannot open '/dev/pg*'ioctl ret: %d None.SCSI open usage error. Supported SCSI transports for this platform:WARNING: device not valid, trying to use default target... scsibus: %d target: %d lun: %d Invalid value for bus, target or lun (%d,%d,%d)Invalid bus or target specifier in '%s'Invalid target or lun specifier in '%s'scg__open(%s) %d,%d,%d HELPhelpscsidev: '%s' devname: '%s' No memory for SCSI structureInvalid lun specifier '%s'Invalid lun specifier in '%s'No Additional SenseRecovered ErrorNot ReadyMedium ErrorHardware ErrorIllegal RequestUnit AttentionData ProtectBlank CheckVendor UniqueCopy AbortedAborted CommandEqualVolume OverflowMiscompareno write currentexcessive write errorsunreachable copy target tracking servo failure focus servo failure spindle servo failure head select fault block not compressible third party device failureread retries exhaustederror too long to correctmultiple read errorsl-ec uncorrectable errorcirc unrecovered errorincomplete block read no gap found miscorrected error de-compression crc errorerror reading isrc numberrecord not foundend-of-data not foundblock sequence errorrecovered data with retriesrecovered data with circrecovered data with l-ecrecovered data with linkingdefect list not availablegrown defect list not found!invalid element address!invalid address for write$cdb decryption error&parameter not supported&parameter value invalid&data decryption error&too many target descriptors& unexpected inexact segment& inline data length exceeded'hardware write protected'associated write protect'persistent write protect'permanent write protect'conditional write protect)power on occurred)scsi bus reset occurred)device internal reset*mode parameters changed*log parameters changed*reservations preempted*reservations released*registrations preempted,too many windows specified,persistent prevent conflict0cleaning failure0medium not formatted1format command failed2defect list update failure8esn - media class event;slew failure;paper jam;failed to sense top-of-form;reposition error; read past end of medium; position past end of medium;medium source element empty;end of medium reached;medium magazine removed;medium magazine inserted;medium magazine locked;medium magazine unlocked>logical unit failure>timeout on logical unit?microcode has been changed?inquiry data has changed?component device attached?device identifier changed?redundancy group deleted?spare created or modified? spare deleted? volume set deleted? volume set deassigned? volume set reassigned?echo buffer overwritten?medium loadablePwrite append position errorSunload tape failureSmedium removal preventedUsystem buffer fullUinsufficient resources[threshold condition met[log counter at maximum[log list codes exhausted\spindles synchronized\spindles not synchronized^Bpower state change to idle^Epower state change to sleepaunable to acquire videoaout of focusdinvalid packet sizegadd logical unit failedgassign failure occurrediparity/data mismatchkredundancy level got betterkredundancy level got worsesprogram memory area is fullsrma/pma is almost fullinvalid sense code 0x%Xvendor unique sense code 0x%X[]no sense, deferred error [No matching qualifier](illegal block length end of medium file mark detected (valid) (not valid) Sense flags: Blk %d %s%s%s%sinvalid sensekeyactual retry count %doperation %d%% done(valid)command(not valid) disk not inserted load/unload failure spindle failure focus failuretracking failurebias magnet failure#illegal function for medium type8recoverable write error9write error recovery failed:defect list update failed=defect list not availablelimited laser lifelaser focus coil over-currentlaser tracking coil over-currenttemperature alarmECC error during verifyinterleave errorbad format on driveself test faileddefective track#volume overflow+set limit violation,error counter overflow-initiator detected error.scsi parity error/adapter parity errorno additional sense informationfilemark detectedend-of-partition/medium detectedsetmark detectedbeginning-of-partition/medium detectedend-of-data detectedi/o process terminatedaudio play operation in progressaudio play operation pausedaudio play operation successfully completedaudio play operation stopped due to errorno current audio status to returnoperation in progresscleaning requestedno index/sector signalno seek completeperipheral device write faultlogical unit not ready, cause not reportablelogical unit does not respond to selectionno reference position foundmultiple peripheral devices selectedlogical unit communication failure track following error error log overflow warning write error error detected by third party temporary initiatorid crc or ecc errorunrecovered read erroraddress mark not found for id fieldaddress mark not found for data fieldrecorded entity not foundrandom positioning errordata synchronization mark errorrecovered data with no error correction appliedrecovered data with error correction applieddefect list errorparameter list length errorsynchronous data transfer errordefect list not foundmiscompare during verify operationrecovered id with ecc correctionpartial defect list transfer invalid command operation code!logical block address out of range"illegal function (use 20 00, 24 00, or 26 00)$invalid field in cdb%logical unit not supported&invalid field in parameter list'write protected(not ready to ready change, medium may have changed)power on, reset, or bus device reset occurred*parameters changed+copy cannot execute since host cannot disconnect,command sequence error-overwrite error on update in place.insufficient time for operation/commands cleared by another initiator0incompatible medium installed1medium format corrupted2no defect spare location available3tape length error4enclosure failure5enclosure services failure6ribbon, ink, or toner failure7rounded parameter8event status notification9saving parameters not supported:medium not present;sequential positioning error=invalid bits in identify message>logical unit has not self-configured yet?target operating conditions have changed@ram failure (should use 40 nn)@diagnostic failure on component nn (80h-ffh)Adata path failure (should use 40 nn)Bpower-on or self-test failure (should use 40 nn)Cmessage errorDinternal target failureEselect or reselect failureFunsuccessful soft resetGscsi parity errorHinitiator detected error message receivedIinvalid message errorJcommand phase errorKdata phase errorLlogical unit failed self-configurationMtagged overlapped commands (nn = queue tag)Noverlapped commands attemptedPwrite append errorQerase failureRcartridge faultSmedia load or eject failedTscsi to host system interface failureUsystem resource failureWunable to recover table-of-contentsXgeneration does not existYupdated block readZoperator request or state change input[log exception\rpl status change]failure prediction threshold exceeded^low power condition on`lamp failureavideo acquisition errorbscan head positioning errorcend of user area encountered on this trackdillegal mode for this trackevoltage faultfautomatic document feeder cover upgconfiguration failurehlogical unit not configuredidata loss on logical unitjinformational, refer to logkstate change has occurredlrebuild failure occurredmrecalculate failure occurredncommand to logical unit failedocopy protection key exchange failure - authentication failurepdecompression exception short algorithm id of nnqdecompression exception long algorithm idrsession fixation errorscd control errorUlogical unit is in process of becoming readylogical unit not ready, initializing cmd. requiredlogical unit not ready, manual intervention requiredlogical unit not ready, format in progresslogical unit not ready, rebuild in progresslogical unit not ready, recalculation in progresslogical unit not ready, operation in progresslogical unit not ready, long write in progress logical unit not ready, self-test in progress asymmetric access code 3 (00-232) [proposed] asymmetric access code 1 (00-232) [proposed] asymmetric access code 2 (00-232) [proposed]auxiliary memory code 2 (99-148) [proposed]logical unit communication time-outlogical unit communication parity errorlogical unit communication crc error (ultra-dma/32) warning - specified temperature exceeded warning - enclosure degraded write error - recovered with auto reallocation write error - auto reallocation failed write error - recommend reassignment compression check miscompare error data expansion occurred during compression write error - recovery needed write error - recovery failed write error - loss of streaming write error - padding blocks added auxiliary memory code 4 (99-148) [proposed] copy target device not reachable incorrect copy target device type copy target device data underrun copy target device data overrununrecovered read error - auto reallocate faileddata re-synchronization error unrecovered read error - recommend reassignment unrecovered read error - recommend rewrite the datacannot decompress using declared algorithmerror reading upc/ean numberread error - loss of streamingauxiliary memory code 3 (99-148) [proposed]filemark or setmark not foundrecord not found - recommend reassignmentrecord not found - data auto-reallocatedmechanical positioning errorpositioning error detected by read of mediumdata sync error - data rewrittendata sync error - recommend rewritedata sync error - data auto-reallocateddata sync error - recommend reassignmentrecovered data with positive head offsetrecovered data with negative head offsetrecovered data with retries and/or circ appliedrecovered data using previous sector idrecovered data without ecc - data auto-reallocatedrecovered data without ecc - recommend reassignmentrecovered data without ecc - recommend rewrite recovered data without ecc - data rewrittenrecovered data with error corr. & retries appliedrecovered data - data auto-reallocatedrecovered data - recommend reassignmentrecovered data - recommend rewriterecovered data with ecc - data rewrittendefect list error in primary listdefect list error in grown listprimary defect list not found access controls code 1 (99-314) [proposed] access controls code 2 (99-314) [proposed] access controls code 3 (99-314) [proposed] read type operation while in write capable state write type operation while in read capable state illegal command while in explicit address model illegal command while in implicit address model access controls code 5 (99-245) [proposed] access controls code 6 (99-245) [proposed] access controls code 7 (99-245) [proposed] access controls code 8 (99-245) [proposed]$invalid cdb field while in explicit block address model$invalid cdb field while in implicit block address model&threshold parameters not supported&invalid release of persistent reservation&unsupported target descriptor type code&too many segment descriptors& unsupported segment descriptor type code& invalid operation for copy source or destination& copy segment granularity violation'logical unit software write protected(import or export element accessed)bus device reset function occurred)transceiver mode changed to single-ended)transceiver mode changed to lvd*asymmetric access code 6 (00-232) [proposed]*asymmetric access code 7 (00-232) [proposed],invalid combination of windows specified,current program area is not empty,current program area is empty,illegal power condition request0cannot read medium - unknown format0cannot read medium - incompatible format0cleaning cartridge installed0cannot write medium - unknown format0cannot write medium - incompatible format0cannot format medium - incompatible medium0cannot write - application code mismatch0 current session not fixated for append1zoned formatting failed due to spare linking5unsupported enclosure function5enclosure services unavailable5enclosure services transfer failure5enclosure services transfer refused8esn - power management class event8esn - device busy class event:medium not present - tray closed:medium not present - tray open:medium not present - loadable:medium not present - medium auxiliary memory accessible;tape position error at beginning-of-medium;tape position error at end-of-medium;tape or electronic vertical forms unit not ready;failed to sense bottom-of-form; read past beginning of medium; position past beginning of medium; medium destination element full;medium magazine not accessible;mechanical positioning or changer error>logical unit failed self-test>logical unit unable to update self-test log?changed operating definition?redundancy group created or modified? volume set created or modified?reported luns data has changed?medium auxiliary memory accessibleGdata phase crc error detectedGscsi parity error detected during st data phaseGinformation unit crc error detectedGasynchronous information protection error detectedPposition error related to timingQerase failure - incomplete erase operation detectedUinsufficient reservation resourcesUinsufficient registration resourcesUaccess controls code 4 (99-314) [proposed]Uauxiliary memory code 1 (99-148) [proposed]Zoperator medium removal requestZoperator selected write protectZoperator selected write permit]media failure prediction threshold exceeded]logical unit failure prediction threshold exceeded]spare area exhaustion prediction threshold exceeded]hardware impending failure general hard drive failure]hardware impending failure drive error rate too high]hardware impending failure data error rate too high]hardware impending failure seek error rate too high]hardware impending failure too many block reassigns]hardware impending failure access times too high]hardware impending failure start unit times too high]hardware impending failure channel parametrics]hardware impending failure controller detected]hardware impending failure throughput performance]hardware impending failure seek time performance]hardware impending failure spin-up retry count]hardware impending failure drive calibration retry count] controller impending failure general hard drive failure]!controller impending failure drive error rate too high]"controller impending failure data error rate too high]#controller impending failure seek error rate too high]$controller impending failure too many block reassigns]%controller impending failure access times too high]&controller impending failure start unit times too high]'controller impending failure channel parametrics](controller impending failure controller detected])controller impending failure throughput performance]*controller impending failure seek time performance]+controller impending failure spin-up retry count],controller impending failure drive calibration retry count]0data channel impending failure general hard drive failure]1data channel impending failure drive error rate too high]2data channel impending failure data error rate too high]3data channel impending failure seek error rate too high]4data channel impending failure too many block reassigns]5data channel impending failure access times too high]6data channel impending failure start unit times too high]7data channel impending failure channel parametrics]8data channel impending failure controller detected]9data channel impending failure throughput performance]:data channel impending failure seek time performance];data channel impending failure spin-up retry count]N^n~Αޑ.>N^n~Βޒ.>N^n~Γޓ.>N^n~Δޔ.>N^ `"+07CPbnz7=+5* -((&f&%%$$h$@(#)scsi-remote.c 1.16 04/08/24 Copyright 1990,2000-2003 J. Schillingschilyremote-1.16@(#)scsitransp.c 1.91 04/06/17 Copyright 1988,1995,2000-2004 J. Schillingschily0.8Շņ3TlՇņ Tlۃbc;q&fg"jjj kmkwkk^`MM-ZN"_"jj,___`3`@(#)scsi-linux-ata.c 1.7 04/06/12 Copyright 2002 J. Schillingschilyscsi-linux-ata.c-1.7@(#)scsi-linux-sg.c 1.83 04/05/20 Copyright 1997 J. Schillingscsi-linux-sg.c-1.83-RH@(#)scsi-linux-pg.c 1.43 04/01/15 Copyright 1997 J. Schillingscsi-linux-pg.c-1.43@(#)scsihack.c 1.43 03/11/28 Copyright 1997,2000,2001 J. Schillingscsihack.c-1.43Zn~ ,Oi+EXn>Tw ,\(;(##$@$p$$$%8%h%%%%X(&P&|&Tn &&('4'`''''( (D(l(8((()l4,)Kf`))))*<*`****+(+$X+|+++H4+(,T,,,,$-X-|--Rm-.<.h...Dh./0/`////00`000 0,18- G h11a y 112  42h2Z 2  # = l2Y m 2 303     T33 334$4: 8`H4p44445X @5l5k  5  !555686Tt`6 66667L7|77   7  77 8@8U s d8    8   88L% 9B ] y $9   L9   p9!;9x'7Qn99:8: 8hMp::k ::;L; F b x |;;;  0 ;<P<<<<0=h=== >@>t>>>?L????4@l@@@AHAAAA,BhBBBCXCCCDz|P`}v397Wo@"#)0 6'1<H *CK5RU$Y[ g:-M Qd/L Oc~2<<r+y.| w^4gq?7 3T WzB|q6'%q ,Z9%;66 - h ^ .B'^6W(H:?6XOxV/z W  @OX9#O- x3l<k8oXS^EFX]} JQa9 :7 -hQ'.35 zOWhHQ(+ 0T:@|& ^ 'kJ=@V3111B<{C G3&]# M%A z69@|xQE 60_Jv_RegisterClasses__gmon_start__libc.so.6putcharstrcpyrcmdioctlgetgidsysconfstdoutreaddir64strerrorfdopengeteuidmemmovegetopt_longsnprintfftello64getenv__strtol_internalusleepgetpagesizeqsortfgetsmemcpyglobperrorreadlinkdup2getuidmallocoptargiconv_openopterr__strtoul_internalfflushabort__lxstatstrrchr__ctype_tolower_loccallocisinffprintfctimestrcatsetsockoptnl_langinfooptindstdinwaitfnmatchmktimeferrorstrstrrandsignalstrncmpstrncpyunlinkfreopen64strcasecmprealloc__strdup_IO_getcstrtokforksscanfexeclpfreadsbrk__xstat64gettimeofdaygetoptsetreuidlocaltimememsetfcvtopendirseteuidgetopt_long_onlystrcmpgetpwuidgetpwnamgetservbynamesprintffclosesetlocalestderriconvisnan__lxstat64vallocfputcecvt__ctype_b_locoptoptglobfreesocketpairfwriteaccess__xstatrewind__errno_location__fxstatsetbufgcvtfopenfileno__ctype_toupper_locgetline_IO_stdin_used_exitgmtime__libc_start_mainlseek64clockstrchrfputsclosedirfcntlsetuidfseeko64fopen64GLIBC_2.2.3GLIBC_2.3GLIBC_2.1GLIBC_2.2GLIBC_2.0$si ii )ii 3ii =ii GW  . / rX X  X X X X X  X  $X  (X  ,X 0X 4X 8X X ?X @X AX BX CX DX EX FX GX HY JY KY M Y NY OY PY QY R Y S$Y U(Y V,Y W0Y X4Y Y8Y Z~AA@Ɖ) ى1)ʈW [^_]AUWS= M] }t ڃ[_]9|@1҅.t|$E$D$1҅.t1эA| uD뱋[_]US]D$=$t!9vx\uD$=$u߃[]UWVSà 0 u^ t.;\ut\1=t K\ň 0 u [^_]È 묉t$$uY贆됉|$$Y袆 [^_]UWVSL[DžpDžlE UDžhDždDž`Dž\DžXDžTDžLDžHDžDDž@Džu;ӋDPu_u'ۋDXt u9>u i €  Шu=i)|$L$D$( L$ D$n$P,D$D$$, $,$0L$$YD$/$.S@D$Z $'D$ $,8$YT$lt$$D$ $;_$YT$D< <  Шut< q uZ Z x|$$+ uዕ( |$T$ L$D$n$與D$B $,Ƅh$$DŽ)xhD$T$ E UL$D$$mut& b)L C u A:t&B"&bt&9z & t&iHZ m1C: &At&,  T::& t&   &i d `v- D$ D$ D$$£Z @T$D$o$} d |Z wOv `&6h D$ D$- D$$Ë8 u~D$ { $&[Z go3g& f df( D$`o$| a&- D$$5pZ Z - 4 h  !C  PV3Y - D$$Q5 Rv  4 -  R HNQ P@D$o$zD$o$zD$ p$nzD$Dp$Zzh ` A @! Nv t&t&- L  vF Z W-x&b .t&/t&=- 1= уD$Y$fy S  ~D$|p$xx r& p0=- 1= у_D$Y$xF - 4X +- tT T  @<  d  v<t&<t&`h \ [? @ D$p$w ] t&0t& - X5PFt&- D$ D$ D$$Z D6D$p$w D  } 0- 4 $/m- D$$1S- D$ D$ D$$:;Z Z D$ q$dvD$0q$vD$`q$uD$q$uD$q$u H Qj+ x gTBK U& V&=- 1=Z у D$Y$Yu3  t&!t&p$ DžD$- D$ D$$Z t:ux=t&fD$ Z$tMt&t& t&- lZ  Z &- xZ  , L  - H $E H  - L $&C@ =D @ D$rK=- 1=Z у SD$=Z$o: .4 Z gD$r$o - $?H  H$ @ D$-   DžD$ D$$ t 8hD$XZ$nO - p>- | -  T H $J4 t$$ع$D$Z fDŽ)/^D$ $88*$YT$mD +@ 9ЉD .- xT 4D$s${mH  l h P 4 @=- 1=Z уD$Ds$lsgvt&0Z z- D$$'`-  O- D  6D$ds$}l d - D$$& H- lZ p - P  H d ~- ln- h Z UD$s$k< H) - t - $%> d $ @ D$-  DžD$ D$$  t 8D$lZ$jy@@ f- l p ptT Z=- D$$^$# p  t$D$s$j]|h D$ D$- D$$Ë|8 u~D$s$iT -1T  Pb- D$$#H- D$$#.D$Z$.i- D$ D$ D$$ d `` $ZD$h$ @ D$-  DžD$ D$$ң t:ux =QD$Z$h8       H- $<;D$t$0h=- 1= уD$$t$gD$Dt$g- tZ m- D$ D$ D$$TZ |5,D$D$lt$og Z `Z D$t$,gD$B $B,KD$t$fh d /. @f- hU  HZ %1D$B $,=- 81=hZ D$t$)f d $ @ D$-  DžD$ D$$ң t:ux =QD$Z$e8 d ,- މt5xuCau C1uC8 8 - 9Et DžD 8 tS t4 '< t4 u Z @ t=Z ~ Z H=Z =Z 4 t @  =  1ۉ$S $FT $9P $,=Z J t( uYD$$ t @ u u uxT D$Y$ xT Zމ ۣ0 £, t D$$D$D$ $txT  $$WZøމ t,Z ~# \$ \$D$$u$i xT  $y $l $Ze 0 ZމUq£, 0 T t [މ$[P (  £$ t D$(D$D$ $uq$1D$$ua $4va$pva$va$wa$Lwa5 @ $wa$w{a$xoa$Dx^a\$Zމs [މR$[£$ ( 4$S(Zމ Yptp$W$D$S)$t4   >tD$x$_  uOuO<9u6=l u,5 u"d u | up W t| `t t A tNL u H tD$x$>_ tD >tD$x$_ tD >tD$y$^= u 5 t  l t d  tv Z t#d u<:u=p tE5Z t` u d `w>td tD$(y$] ( 1ppt5 >tD$`y$]Xt&X-uB  TTU D$- L$ $ED$ OP& D   5@ ``D$ $T$M`D$ D$y$Lc $ `D$D$ $=Z ~`1"U D$[D$ $b;]|١ D$[D$uD$ $[D$Z D$)[$bPtP $\T \\\\h  \($D$D$T$ (,$T$DD$`D$ $K E( 1p pËp$mddAAȃ$D$\$$7H$i(t&  D$D$D$ $9[ x D$ D$YD$$34t4$肼5l X- T$T$ EU D$ L$PP $3 T \1lDž!\… Ш l1tAlD$$R1эA/t Ƅ(/ȋ\t&\P\=.r/u;/t\$ $9r\s\\U\(   \D$$fu%=@0 3.tO/u 3/t<.t<t{/t&.uӃ3<.t뱀{/.t{.t&uȀ{/u‹.t; .tJ3뉍$V[T${WJ/.3<..r{/tv$yt5T , h 31ۉ$~. $`   >tD${$^U 4 u<   $x  >tD$b[$U B B  tT   dR   Шt   Шt  uD u @ t $\ KnL u H t $] -n=D >t $] n$[  n$[ m5h >t $] m=Z >~ $[ m4 >t $x] m$[ m < >t $$] m$[ m< >tl$L\ tm$ ] hm$\ \m$\ Pm$4\ Dm$\ 8m$\ ,m$\  m$|\ m $p[ l4 >t $`] l >u $X[ l4 >t $H] l$@[ l| >t $([ l $[ ~lU  ۣ >u2 {Ct$S&5<  Z L qH  [H t1Z  "- $] kZ    U tiC5@ t*9t&t$CD$ CD$@{$D$Q{ t%=Z dR $S =Z u @ 9tD$ T$D${$>Q Z ~S$D$|[+tD$ $W ЉT$D$[ D$  $We1[^_]á@ )D$ CD${D$ $W<@ D$ CD${D$ $cW$$LU .CuЋq=< u5@ u< u 4 tD${$PptD$@|$Oh u-L u$H uD uD u | tD$t|$O= D$|${O t Pɉ\{5( \T$ $%=@S 0 >t4\D$T$ AD$A$|D$O\D$ D$T$ $,- DžL- 腿 $ 4 4 #$` $@` g$(` jD$ t D$}D$}$[8| *${\$\Z u K&$Z |gZ tࡴ $!&$d\ Rgh\ >t  $ҋZ >t!$\ &g \ >t  $ҡL  XD$B  $OTX$}D$MD$~$LQ D$[D$uD$ $[D$Z D$*[$S`$[L$LN D$D$D$ $d~^ D$4D$D$ $~    D$D$D$ $[뮡 D$D$D$ $[rm D$D$D$ $[H7 Z$5T ^ " ƒ.uQu܃.u A.uAt @.oD$~$ K D$\$ZdR $\J l  D$Z$YJ\D$$# O- D$$D$~$ID$$ID$T$ID$$I\L$$ P\- D$ D$ D$$c MruCau CwuC'\$D$$8 0 `I       Z Z $'Ip$T$ I1эA=/.Ƅ(/Ƅ D$[D$ uD$$[D$Z $*[N$*$Z 0bZ f $W`$[L$LHup$4T$%HQD$\$dR $\GP\i0 \L$D$$i@.M 0 $0\G\$;\L$hGFfN@@ @yD$N\$G\D$ BD$B$|D$7G?Z >~$ D$+ D$ $M $+ D$L"D$Ԁ$FD$l\$#Fy@$Z "`Z $u?x u6=t u,5` u"8 X uT u P ti PD$$E ` aD$0$ED$l$OE  $Z I_Z [ $L\D$/ $$\9 Шt#- -  D$AYD$IY$K D$ D$ D$$\mDžDžܤDžؤDžԤ-Ԥ ؤ ܤ .ܤtǡ D$D$D$ $1DžԤD$ uYD$ D$\$JtTt $ D$膶 4$D$ܵ1эT  ؤD$\tYD$ uYD$ D$\$I1эQ 8 $ D$+~ۋܤD$GB D$ $Hr t$D$$H1M T $ D$芴Dž;D$/$tt0 >t.L$BD$ B\$$D$AD$ D$L$$_/!- D$\$D$@Z UVS1ۃuut$$D$[^]É4$u$\@ǐUS1ۋP%==@ th  t A t  At:%=tJ%=@tNЁ$ItmmQ[]á t덋 늋 낡 t̀A[]á t@AUVSu t$E$D$x $ u [^]É[^]UVSu t$E$D$赳x $ u [^]É[^]UVS 4<D$EE$D$4};PtQCU)‰UCÃ~OC,<vCD$D$ CD$`$D$<>;Pu{XuC t$$< [^]US$4<D$EE$D$荲};PtQCU)‰UCÃ~ZC,<vCD$D$ CD$`$D$=;Pu{Xu $<$D$?<$[]UWVE S]D$D$$} AD$E$D$PtxMtqCU )‰U CÃ~ZC,<vCD$D$ CD$`$D$<D$E$D$دu[^_]Ã1[^_]UVST @@@p 0t @tG6u @? @0 X C u[^]!T X9stGuD$$D<t uT 6l[^]Åu빋C D$m<D$4$;t@,D$B$V:D$p<D$4$.mC,D$B$:VUVS]u t 9C,w'Ku u[^]Ét$C$t$$MUS]t7CD$C(D$ C,D$sD$ $ACu uɃ[]É$UWVS ut F@@t6u [^_]1ҋ^C@uN t  t uzF[F QFtC <uFo$Q6bUWVSE uEE$ D$/$蚩9tb~EG$D$ѩt?u1[^_]ËEEE$読D$/$89u D$:D$D$ $ D$2D$D$ $1C$щD$L$親D$/$趨^  D$E$tuᐍt&UpU tÍE$Ъ  t1 8U  t%  Dž`11[`0 5C0~C7 5G0~G750 u2$ptH#` ~`7뚍$L$f2$Xpuhlf9Z ~H pD$ D$D$AD$D$ D$ $u81l򮍽уJ(=< хq u @ ttq!l8lBL$L$^ tlD+l$anll]$HD$;$L [^_]Ã`qƅMe {pI ɉl l҉ll @uۍx)1ًlB!эqx @ƒ.uQ`.u@B.uB@ BtB  t l!B(8lHl҉lp19 T D$ȃ $6\~!pBD$$D$.dp1I ɉllld9l.tۋltˋ @ƒ.uQt.u@B.uBt tlA!xl @eCD$ lD$ld)D$D$ИD$$v9d1l򮋂щ$t1ޢl :ǁ p;  u1ً@uѡ  t$D$D$ $1-;Xt"Xt$D$HL$ $-pp@ B lll/l @uۋlprQ(%=v 2pB(@ l<984tt$D$D$菠tC)‰tCÃ~f;Cu{EuލC$+pP %=vp%B  IpA t냋l l\#``#l D$p$D$N+Bh$kZ ~Tlh pD$ D$D$AD$D$ D$ $11h򮍽уJ(< хq u @ ttq!h8h׃)BL$<$詠h$g NhD:B(C(C)|$$dKl${gl wxZ $.hpp9 T .]y,RA l.b1 l ɉll @ƒ.u @Qt.u@B.uBtt lA!ul @u҉DqXэXKD$. $軜H9.B(C(C)L$L$CLD$$T$(pB X.$`D$`dD$$upddǀB J  A!fǁhU D$ȃ$kdǀ$ǀ(ǀ,ǀ0Z D$d$$%dXT$$&XdT ۋpxZ $@Xd $Rd\$D$$7dD$xZ D$$< u @ WdxZ D$D$ U D$ U T$D$$Y0U $4U hlǀ UWVSM }ɉ}CD$/U $iUt.EXt$Ett$C$u܅ $PD$PD$$U C{C $莙CD$/E $XH$eC(CHC,CDEC4C0utT 9EtOUB$Z 9wlUC$BSuZĜ[^_]ɋuĜ[^_]á C$ [Ĝ[^_]Ëu T$D$ E D$̕$D$$UB$fEtEP:=0 1}Ut U E PC$uXECĜ[^_]ɋu዇ $D$&$E E $`D$`D$$UB z 4$萗 E $UG!Z fLJLJ$LJ(LJ,LJ0D$G$$W!D$|$4$2< @ hU D$G$h $TD$TD$$pU HC,hU C0|$t$E $E$D$ Z D$D$ U @D$ U |$t$$Y0U 4U d-t$UB$$D$S"UWVESDž\DžXD$U $/(L$Ƌ] $bƒI 9U 8%=( tAMƒ.t,.u]C.tE%=@8%= %=( u%=@Pف 1`~rvct&S@t&Cژt^ ߘtQ@tD`t7t*ttf] D$ \$ D$L$&ļ1[^_]Å2( @ Y E1EEÈEEEE]E%=@BE%=@E(D$`D$$ԒE%=@ }1}t 1\ $` D$`D$$]Dž`C LJ{ E$茒U ${C@@LJ @M; T tA@ud]ƒ.uStV. >tHD$M $, =Z >~E D$D$ $$ U 8 BLɉX4 tJ]ƒ.uSt5.uUB.uB>tXD$M $X!]G G!EЉD$G$֔G"G# 1\uLJHLJLLJPN O!LJDE T tsM‰. .uMA.uAhHIMTTBDxHB,pB0]#\$$ M5 Uƒ.X .uUB.uBDž\D$M $'=Z Dž\8QN( Uƒ..uUB.uBzEUT$ D$EUT$$WEUT$ D$EUT$$:W8'XT.M KL$$LJ Mƒ.uQR.AD$E$ =Z  @D$]$r =Z  Mƒ.uMAu]EfK@ƒ.uUB.uBuMfI@]Ct ;T zELJ$LJ(LJ,LJ0Z D$G$$E%|$=@D$M $FLJ8LJ<LJ4E%=@8 ` Шu,t$ttEU"LJLJEEED$G$@ tHt G!Uƒ.uMQt,.u]C.jtE%=@  ƒ.uQti.Gt\8%=@  =]= aL$D$0h$^#$ЋE%=@ 5@ tM;  I 1}tOHtE8%= G!Dt >u<$ی tD5< u @ t1`(MD$T$L$ |$]\$E $`Yļ[^_]ËEU䉗($EU0,E $̖D$fM.uAi9UU.u B.uBM(D$`D$T  $蹉D$`D$T $衉yD$E $98D$T$ $AMX;AL.4 4 Uz ?.jML$ $wu܅.HUƒ.uMQ,.uUB.uB  : T { ML$ $t?uD$ |$E $D$|$] $\$ 8̀8Mƒ.s.u]C.uCD$ |$E D$U$ |$M É$L$( 8̀8C hC$4CC$" Ct CD UB9 ‹t 9u$߈O!XTtB!tyHDHTTE $̖D$2( ?IUB.BQLJD0]KBC]C.BC9A.AMQU D$$T$^MQ CC  ALJHEUT$ D$EUT$$kN(\$UT$M $yXE$D$n$ƍhD$ %=. XD$ U\$T$M $`(U\$D$T$ DD$ML$] $SAU.u B.uBfLJ$LJ(LJ,LJ0Dž`b]D$`$T \$ qM.u]KL.uMA.uA/EUT$ D$EUT$$7M@ ]  D$$\$$8^ .uB`U $HT$ |$]\$E $vs XD$|$H$9Z U9B$lT #$`D$`É|$$%MǃA $wU B $]T B MZ fǃA Z D$C$$P < u @ t/(UD$D$T$ \$ML$E $dQT D$ \$U $T$i\$M $L$EEEeGD$$  G!LJLJLJ$LJ(Dž`=.==`t& EU 0 Ή%t$ L$ D$6D$h$C|$]\$E $r  =Z Dv LJ$LJ(LJ,LJ0$VTB@HxB,pB0ED$] $=L$D$DD$E $MQD$U $M  D$JL$$KU  D$hT$$*$TvD$TD$$aډHL$D$G)D$D)$;Dg<$zLD$|$H$ D$] $d$}$PD$PD$T $蝀 T PCXT C$$ |tD$ D$$~CT $ V|tD$ D$$j~CT @,$`D$`D$É$  B T Z fH@X@$x~  P B! B fǀdD$B $辁 B ǀ$ǀ(ǀ,ǀ0Z D$B $$D$ @ D$T @$5< u @ tTT 0U mA4U D$D$ U D$ U \$uD$$YKT T ED$ED$ M D$l$L$E D$D$ $6D$D$  hU $ xD$  !Ƃ   D$$D$-L$D$EU 0 Ή%t$ L$ D$D$z$ ytD$ D$ϙ${CT $ hy.%D$ D$D$ |$U T$M $E(D$`D$$?{( (M(D$`L$${EUT$ D$EUT$$C붉L$D$ڙ$  ,^qBb$A|5UWVS<=Z uUfJ@xM É $?{Džt$Mv… ШmMZ Q$9 @tMfI@@tEfH@XUDžBLuqZ ҍX<D$~$uZ .~\$D$ $ t $Wu{ $yUBH>t$fMAH<[^_]Ë=@ D$T$ E D$$D$5 $dyD$#$t߉эqэA9e 1} ߉ʹсU $T$zр)/tfDŽ)/\$$wD$$Ktq=Z D$D$%$vn+\$ E D$$D$D$.$D$ $q Aƒ.uSu UB@#.u C.u MA@D$ \$D$U$-E $GD$;t$1w<[^_]ËE D$dD$ $ xZ $D$r.=Z LD$qT$f!f1p)D$މ4$erSrCt&D$$ D$$D$<$UE UB]UU MЈQ]UE UBBB]UE UBBB]UE UBBB]UE UBJJJJBB]UM]Q Q Q UM]QA Q  UM]Q Q Q UWVS,  E}ɉt~\ t<$Dt\ utT $&q\ D$ \ tT D$dD$$ |$D$\$qE"8 ] ]=L#ƅƅƅƅƅƅ`ƅƅ|$ D$D$$Pu~v|$ D$D$4$0u~V~l1}uƅƅ넋E|$ D$E D$$t~+E )],[^_]øՋE$lD$E D$빉\$D$$E|$ D$E D$u.d=?Y'\$$Y6USÅt C@@t u[1]Ë\ B\ C,S8uFC(  ‰K, C  t У Ct{UWVS\ED$$qEJEUD$ D$EԉT$$mnu} | D$$` \$rEԉD$ \$D$$` nx|C1D$ED$D$ D$\$$` ۉJZ @  ȅ҉Eģ@ , Mbi)U9ME$n1R@ 1P },$R] PE,$)ЃPE ]<$$fE$Em]mމ$ pEȉD$  D$$\$ $mlؙ)ZYыE i҈4Dt&6E$D$pEԉ$uB(D)t @uB(D)u~q43E \$^d X D$ -D$<$j1ɃD9DU<$ld [^_]D$X$=d U蒾R "R  @,$R D$ @($R %D$U D$$R nZ $R R D$R R R 1USEE SAX9Xt []DËC[+A]UWVSt&_ tXtuGu`?uڃ[^_]Ë$(T$ D$,0T$$}1.t@D$C $Fl?UWVSL DžDž8 D$B$(htl1yэyv|$B$D$jƄ=$tDžY ts 4$htVu닕B ɉ!t$cL [^_]Ë$(T$ D$,0T$$/=Z dG4$D$GD$C$4 =C!3G XX9}ʉXǃX D$ D$@D$D$ $cDžD$$} ƒ.uQ.u A.uAC!x9_tA?ut$թ D$$D$:9_uG,4$D$G,1ҋG(%$D '-G(%D$C$Zƒ.uQ.u A.uA; #A@,4$D$PB,B(1%$u,QB,B(%D$C$7A,4$D$|B,B(1%$+A,A(뇋 $(ȰX@8 1LPA T Q$ T $5 (^BxZ BD$D$ @D$ $D$WA  QAD$4$& $* 1% =8   tB =Z L$D$ D$ΛD$ $ 4$D$Tx@$D$e $cBP T 5@(D  D$$Vx`Z z1 D$ AD$؛D$ $gD$ D$$D$qD$$eUWVS w > ubut  tHtD$jct]64t$Pc ǃ4t$4cǃ t$cǃuGG u?D [^_]$?$baUWVSG)Eǃ}?CuEuG$JEЋE%E=vEe]]؁ D$G$G $\$}GUMUL$D$$g^EEE]G)Eǃ}S<4UH 8UD$L$$^8UEtMEM64$j_ǃ4$nMEL$D$$Y_E @  EyAyy oPyUaUSÅtC@@u S8` Cu u[]t&UVSE EAS@89B8r!wA)E C)E[^]hY[^]UWVS  $~$ q\$  D$$]^ \$D$$D^\  $%\ ` D$T$$^ \  ` D$ >D$D$A$L[\ 19}% ` Ë9r8tr8؃9|u ` 9/{GG(  E𡨠 M   M  S,T$   $/C,D$  $4CP8 @8D$   $C@81ۉD$  $ 0L;)    L;)    ;]|ˡ t ;5\ }m ` t$D$${D$$T$D$$C `  $[  ` 9tD$ T$D$0$(1[^_]U1WVS] UuэA9~ЉE] u[^_]YUS$VD$D$ËE$v] Cu] U []É] []UWVS<}D$D$$Z  tO1ۡh 9}>D$D$|$ D$D$ $h 9|@    )ȃ=Z ~' D$D$d $5P FD$D$|$ D$F %D$F$^N ۉډ5 1% @ @ F L F$xYF u 8 tLF1ۃv~#€; Шu8u€; ШtΉud=0 uEEu1[^_]t<;<; Шt<; ШtUB뾉tʼn|$t$$@TYt$Ld|$$eOt$$eʀ;`E6E${D$UVS1ۃuF)d  9rtӋu[^]Å.tt$5[1^]Ë UV1S  $4؅u ~ԃ[^]ÐUWVS ]t4t-UT$U $T$XZ D$  $ D$  $   ң  u  [^_])E|$D$ BD$D$$ D$ء$D$ D$ D$葽D$$}D$$谽 ۋ )ٍAD$ $ UWVS  < ]  U1  @ƒ..u C.uC}1W)EуH(UB(!B  UE]+ED@;E EMMƀ Pƀ Xƀ $ƀ A  D$$ٺ ]S  T$$赺 S  T$$蔺 S  T$$s}O ȃ% = =` Ш+  C0;  ]MƁ PƁ NƁ Ɓ S$C   $% É\$边}G W$  0   $L$艹 O    = UM]}EU+ED6;E]}MԀƃ Tƃ Fƃ ƃ ƃ   GH$D$1 W@  T$$1 WP  T$$1 E tH+   ;  M@ƀ Rƀ Eƀ ƀ  Etl E+  (; MD$Ɓ PƁ LƁ  Ɓ   $߷ M Etm ؉]+  (; *ED$ƀ Cƀ Lƀ  ƀ   $l M  tUB%=sER ]ԋ}ȅ҈ >t )ЉD$ $ $w E4< uЋU8 D$ D$ $+ Č[^_]SMA(UB(!B3 B= E  FMA%=5@ .2E    E)Ћ= D!UM9}EEƀ Rƀ Rƀ ƀ Eƀ E ƒ.uSk.u C., 1]эq UE+ED";EN>E}C Ƈ N9Ƈ M Ƈ = M tUHtT,  T$ 0 T$Uĉ$] )1}<b   = UM]}UEU+UD!;E~EE)E]!\$D$$$脵 MUB$ D$| MQ  T$$X} 1ɋW @t tt@tt@ L$$ ƀ Xƀ Aƀ ƀ ƀ ƀ ƀ ƀ  F <  ƀ Sƀ Pƀ ƀ ƀ ƀ P Ƃ    _}HN E+  *; 0 M}Ɓ AƁ AƁ Ɓ ʋH@H  H @I H @J H @K H @M H @N H @O H@P  Hf@9 H@8 ȃ  MKt   = EUM}== }3ͼ MƂ ̀F(m Uap= }+ED$D$ $ Eƀ 1 ED$у$M|Z ME q 1E >uDEU ~ D$ D$L$Ե =   M؉]})T0 9‰E"E.E}+ED0;E5MUEƂ SƂ L]Ƃ UƁ Ɓ  ;}D$/<$EtmU<.& +  ; BƂ Ƃ  Eut}E}xo]UMۈ  =   ]Ɓ }EUE+E}D0;E + EZ    Ћ= U)ȉM]D"}91}щ΃>u+.E    EUM~}UE+U;D;E~E)}E)EUM\ }9U T$ \$  )މ$! MU؍L ])]ң M8}.K]/Et;=T t ,[^_]Ë ?u,[^_]ÍD$D$$@ ƒ@ \D$D$FD$ D$+  FNNNȉD$F N N N +  $D$D$\$ D$D$$vt  uF!. vuG@UWVS1ہ,}D$D$4$ƅ<] V@FD$D$|$ D$D$4$S~@ ,1[^_]UWVS\] u   D$$ D$<$ @ Z $ @  "$&(,p$ $D$  D$D$褣ڍ0$Yuj] ` l$D$zD$D$t$ D$D$<$跖D$D$<$ @ C@ Dž*UDFDž LV DžInfoƅ ƅƅZ \$RH$D$D$D$t$ D$D$<$ݕD$D$<$ @ C@ ƅDž+NSRfDž02ƅn  ] +  F$D$D$D$t$ D$D$<$D$D$<$ @ C@ <Z $tdT $0ƅƅ$D$D$D$t$ D$D$<$ȓD$D$<$ @ C@ $D$D$D$t$ D$D$<$OD$D$<$O @ B @ D$D$t$ D$D$<$D$D$<$D$D$t$ D$D$<$譒@ yȁ\1[^_]UVS $D$D$5@ ] F@ LD  I@ D. L+  Pfp t xz|غ 4$D$@ B@ E$D$ D$D$D$D$5 1[^]US$$D$D$@ B@ E$D$ D$D$D$D$轐$1[]UVS $D$D$@ ] ƃ@ +5  cN>;+(fhZ $'C(Z $  @\+   غ4$D$#@ ƒ+  @ E$D$ D$D$D$D$= 1[^]UU 1UU 1UWVSÁ,D$D$<$9@ s=D$D$t$ D$D$<$衎@ @ 9rÁ,1[^_]U  U]lU U]VUWVS,@ L }XuD$D$4$)@ 9sEB@ !D$D$|$ D$D$4$̍@ 9r,1[^_]UWVS ]MUVS]D$$$>D$ yEY[^]UWVS U ]E2 {X{1tQǃtJG !$DeG !$DڸL4$@ڸL4$ E tG!D$Ĥ$D$褊D$$萊D$<$Ê~*C<t"<tڸT4$ڸT4$. [^_]À{A{ 28 uD$`$8 D$g$ UWVSÁLDžDžDžDžSB<uuuupumu u@u u u u3C$,C $C$ C)Ã1uL[^_]ÍD$t$$u$ CD$D$`$D$ ‰D$蘇L[1^_]UV1S1ۃU B !T!)u ~zXt,UMtUE$\ É[^]ÀzAu΀z uȃUWVSÁ\ DžEDžDžD$$D$fÃC,<މ9މu3C$)C $C$C)CÃ1uhRU t 1\ [^_]ÉЍ)$D$jD$;$t$M 벍D$t$$s}<$\.pCCD$CD$$CƄU th1򮍽ʹ҃4$щL$l} T$$[l<$U ǂ@CD$D$ CD$`$D$d\ [^_]UWx VS\U<$$CEF$ۉ $T$UT$ r<$EM9EԉEEUM9M}}UtEEދE$CE}؉EE9}ĉEEE&EEE܀8EeM9M|EEԋ}9E}}jUЋ2F(EF!tD1;}>|:MЋ1EȍV)M̋L$T$C)$u C!;}|ƃEEE9E|E1}}ąu5< ]t }<$EUԉEȃ\[^_]$`AUЉM܋L$D$$E܃}ЋE$U܃ U$ǃfǃǀ(ǀ,$ǀ0ǀ4ǀ8ǀ<ǀ ǀDE0ǃ ǃ@ǃǃǃdžHUM܋]܃!!UQ )E̍<}u m}= EeƆUЋ@(ϋM܀y w p t}ЋD$E܉$BMЋ4$U}Ћ7~(+xZ 1׹T$$уL$u^EЋ0 xZ $} <$EE$EEuEEUEM̅.Ẻ8<$\?UЋM̉4}싀4L$|$$EM܋EQ 0ҸD$t))ЉuD$4$~) ~)$tD$D$h$ r]$u>ۉE UMD$T$ $lE}}}*E+E;E}'U< ttEE+E;E} M< uE+E;E}}EUԋE9UEEEԃE9EMЋ1F(]ÉẺ+E;E}ʋUF)}̃|$D$$6uE|8 uCD$ $Åtx}Ћ7@u# >t $ 7$ UЉUU+E;EM $$MЋ1 $UЋ2?$7D}Ћ  NEE  5\$D$$.}< D$5D$D$ $ D$2D$D$ $ D$-D$D$ $$k< $.;D$D$gK$EЋ01߹у $;U쉆\$ MD$D$$複USà u,u44u<uD$[]É$t̉$4tĉ$t$$[]UWVS ~ttMu<$v [1^_]UWVS|Dž] ~%Uu9|1|[^_]Ë t.uBtʋ  t} $D$uE@!Dž4u11 uIEu.MB A B A}4EE}|[^_].u B.uB8DžDžDžDžDžD$D$$Ã>u nE<DžD$\$$fC,<u4C$MQ%9tDžDžu%Cu3C$|C $kC$ZC)CÃ1UM؍<3BHu؉ $D$󦋵!;u}؋FP<$u؉D${ !C $ E<CD$D$ CD$`$D$qvUS]D$$, t 1҃[]É$oeyU]fUVSutl @   ( ( D$,$t'( D$ D$ D$$~CD$ D$ D$$Y@   ,1[^]á( hD$T$luOD$$SuUUWVS1ہ,$cYD$$T$b=tE$D$uuu1dtW=urxu:$3D$Í$D$؁,[^_]ÉD$D$$s,[1^_]ÉD$D$UWVSLDž4Dž8DžD$D$ $B,<pJ$ $$sB)Bƒ1u;L[^_]ÿMuH둋D$\$ $-`DžDžDžj$ V1Ë${0 KC0 BD$D$ BD$`$D$wq0$ 0H4 P4 UWVSL DžEDž9Dž>| M94t׋ t< =xZ $|$F $BM9ztdw =xZ  .uJ ; u։|$ $Ft úL [^_]F! ƒ.t.u A.F F$4A A Q<.u B.uB.t&=xZ |$ $ 9u0G L [^_]ËG4$D$1fDŽ)/ 4$D$4$[4EAI$Pj-D$PD$$QA$BB$ArB B(B,JQB $D$1򮍽fDŽ)/ <$D$<$oB<$^GFDž1;.U!;.&Q! ut[A A .uBu fH@ .u B.uBu fJ@ȍHA<$D$1fDŽ)/  $D$l$A A ‹u: D$D$D$ $SD$C $jPUWVS DžME tU:/uEuUtU:/uEu$}E8$ ]t2D$ D$D$U$BEUZEX +}( |$$Y)t$$)T$t$|$ \$$D$$nut ƒ.uQp.u A.uAVD$ \$D$U$AUT$ D$$T$ $0DžE2u$L [^_]ËUD$$T$gXEtD$P$g 1[^_]Ë D$D$($9t  (t [^_]ËED$$D$fË$$EGUWVS4 t&50 =T t 9tIu[u[^_]ËSAAStҋG >u ȋ.tS9uCUWVS 54 >u Bvt"~vtT  @XtLvuދ54  ^4$ޅu50  ^4$ޅu [^_]9{uD$$el^C D$m<D$4$'t@,D$B$cD$p<D$4$z'.C,D$B$cQ8USE M]9t:Pt*It#BDBt:t/ @ t Ã[]$d@ ߃_[]UWVSu_ы]܋MDWMAPUD؃E]܃;E =E t M] DUE؃<[^_]ËEx뗃?.t\ut&끋XM]M]1}E $щED$YD$ D$]D$] B] C4SUE|$T$ D$$jUt$ÍET$ D$$J ‰to1.01EfMfU E f9.M>.,1[^_]ËCHTϡ( FҸ륋C9ы@ H;T @Ã.uMA.*8 }}t&;};u ;EMD$ U $D$T$=ƋED$ UD$<$T$uE 11uYEfMfW E f9r8qU҈UBM%};!;!,[^_]Ë U0 U1HTE ( Z MD$ML$E${D$ D$ $D$#VL MAB u8.# u8A}E8.,1[^_]ùU1WVS,U҉UkM; T t 1A@6}_ =1 / uC! Eƒ.uMQ.u}G.uG tHtTM0 D$ ${   EMƒ.uQx.u}G.uG[ tHtT0 D$ $" U1B@B 1BU u1$8MÅt uu~L D$ ED$t$$t1ɃDB9D}@$E5L Xt [uuMQuc}?},[^_]ƃ "U; T}> P tV  $$!t럋  U( D$HU( D$H } W0%=v  [UB0UWVSL+BtB@;T @@u 9B4vB01%$D$T$$@B  u٨ t6T p 9i6uD$$CK,0< w<u< :}؅;uMuVUȅu. u%Z ;EmmE.ẼEU  uE;1ẼEUE UfEEEE܃L[^_]D$.4$诵E.EU;Z 9uąt+}#B< w ËẼE  .EȅE9EEȅE9EEɉ u ߶Dxt ̴֡ 9EED$/$%sUXt$C$u]uE$`,D$`D$$U54 B BLZ XC!fǃhU D$C$Z ǃ$ǃ(ǃ,ǃ0D$C$$8C$D$8Eǃǃ<$ D$\$<$ < ' ɉ u @ t@t\ t ' @Uǃ,[^_]á ߉ED$' $XD$D$ U D$ U \$|$$Y0U $4U {_t$D$$&9% D$0D$U$DE$D$D$U$E艃,[^_]É\$D$$8HUWS t[_]$ ǣ  u   [_]Ë   [_]U ]UWVS  D$D$$ 1Z f 1D$   CD00  EL T ORIT O SP ECIF ICAT ION$UEt uZ D$Ԯ$D$P7E $E6$ D$|5 1   PtG1ljىуwًPэQPT$$ D$XP U D$$ 141  Ã~$ \$q4M  B B B  B B B BE 5 \5 ~}V1ۃ\ÅEMEȉ ẺD EЉD EԉD E؉D E܉D ED ED   M\ uED$D$D$ D$D$$ y4@ 1[^_]Ë\BD$ $pع}󫋕\B<$EȋBD$Eȃ$2\yu;pۉȉfƉ 1% tZ ~ |$D$$T;\F:Z E~% D$D$D$ $D$p$ǧkD$D$% $=tp$(D$3$٣' f'  fUt$pD$T$D$B3EDžXXa' f`'  e' fd'  b' ҄h}CE̋\@u4X^' t% D$&D$D$ $萨ڍ% uX_' ƒ Шt% D$,D$D$ $:hhXh? ЍPc' h9t T$D$$ 9X}KEȉ|$$0p $0D$Eȃ$$0\AD$p$^dEDž`DžTD$dD$ $}~q``?Q1 $/T~ዅd`D$D$ $ p1ۋ`11 >t$pD$$D$0dD$ D$D$$WU1׹󫡰 $D$.pD$E$.pD$E$u.ET$t$`.dD$8\$<$͟<$  D$)؉$D$pD$DD$$/D$h$/= \@D$$ +`D$虤pD$$D$//\H tsZ E. D$ D$D$ $薤pD$İ$D$.Xb' @ tz` Z E.d D$D$D$ $+:D$G$-.Z E. D$D$D$ $a뜋pD$D$&Z E. D$D$D$ $}Hp$$D$-t\AD$P$D$^-E$|D$e-UED$$' D$臢?( UED$$+ D$]+ UVSp@( A( ]B( C( L( M( |( `}(  ~( ( d) e) ^f) g) h) i) n) o) p) q) r) s) t) u) v) w) ) ) *- $D$,藛tt~D$ѱ$+1N( O( P( Q( - .uC.u C.uCE$D$D$$脜EċUD$D$ $T$zKȈ ) ) ) ) N( O( P( Q( p[^]É\$$*JUW1VS|) `)  ]) ) ) ) ) ) ) ) ) ) + + + + + + + + + + + + + + + + + + + + + + + + + + + + ^+ + + + + + *- $D$,轘tt~D$ѱ$(1 * *  *  * * * * * !*  * #* "* 1- ;GE$D$D$$茙EUD$D$ $T$HȈ* * * * ~Ɔ * Ɔ* Ɔ * Ɔ *  |[^_]É\$$'I|$D$$t'U1ɉWV1S ‰ÉܸŸUЈ) ) ) ) E - t&.uB.u B.uB͂) ̓)  ́)  ̀)  tgfff|) }) ~) ) )օ.E]BU4E+E܃[^_]ÍAʃ)v) w)  {)  u)  t)  z)  y)  x)  .jډωUUUUU|) U}) U) ~) ŀ) Ł) U؈ Ń) ł) N( O( P( Q( ~UE+E܃[^_]úUWV1S1ۃE ‰ÉŸUЈ* * * * E .t* *  *  *  tU Aˆ * *  * * gfff)Uƒ Ш]} ZM* * * * A'* &* ljƉ*  * * * Q * * * * %* $* E+* ** Ѓ)* M~- - Ј (* - - - - - - -  - - UU- xE+E[^_]ËE+E[^_]UWVS<D$D$$蛗 @ ̍)ȅ~CËED$D$D$ D$D$$*!@ uH v<Fw bu - tt.uA.u A.&b* *  *  *  ‰vD$ $iSÍD$D$$3D$D$$ED$D$D$ D$D$$@ u $肐H  @ +  ۉL$ u D$ D$<$ '<[1^_]) )  )  ) AV- $ZD$- $YD${U ; tD$d$  1UWVS,D$D$$腔 `H =+ + ,) + + 0+ 0+ ȃfލD$BD$~- $QD$D$) $3E$D$ D$D$D$D$@ ,1[^_]À=' ' tQ' ) ) 0) 0) fuD$D$' $Y fIJ D$$xxEt\E+EЉE؋U؉T$MЉL$$u*>у9MMhEEuE1}ESM- 1jMARE- 1}EЋ}хL - tMU EPA@ 1r- ;- t- <[^_]Ë- 9- - 9tE - ;]U 8-C;E- }pM Ë:-uzu_܋]- ]- BH- - c- 9.v- kÉ- BY1Ʌt<-D - p- UЋuЋEЃ5- |$U$识UR- €:-  Шy:t <[^_]Ày:tsUЀz[5- - - ʡ- EcU܉uUD$E$. - M,EЀxu- 뒋My;U$CM - UB 2xuvt)M x-tUD$M $u ^ tDE z-r- D$D$ M D$lD$ $c- - YC- ?- ;UBM - - E܉uEE=^ ?= ^ ,^ )}ЋU1эL - M9:D:^ 1}ЋUэL - )^ )= ^ U<:|:|$ M D$4D$ $04^ tKM Dx-MD$M DD$ D$D$ $- E1}ЋU?эL - M DD$ D$D$ $- EM D$ D$ND$ $Y- - E|$ M D$D$ $$- D$ U D$ D$ $UD$ D$,D$ $ - MUED$D$D$E D$ D$E$ÐUED$D$ED$ ED$E D$E$PUED$D$ED$ ED$E D$E$ÐUWVS, ]}  - u @EЙ}؅]>e - - 9~Ӊؙ}D$ ËE|$ $D$3x- $襣t $YE])DžE[ ^_]É$aD$ Ƹ4$D$T$ !Ѓt0]|$4$ \$C9t $YD[^_]$r.USt]TED$ $D$D$@D$D$ D$P\$E$o- D$$ߠ- D$- $- x]%D$- - $z- D$<$4t[- @$$- h$t[]뜀}uYD$\$$t[]á- h$$- $U, u- $É$EÐUS]$议t{$~1[]É$$uۉ$%t$t $ uUS]$Dt$71҃t[]É$菮!t1$肮 t 1[]É$襮 u[]É$苮t$uUVSu^@D$D$l$CF$CTC CCCUV$ЈCUFDɴu[^]4UWVS ]C$$lS$BxC$ [^_]ÉS$1$4;} }\$%yNC@@(uՉ$GE$ͬtuC$~BC$1뗃}:ƒ}0 Шt؃k$ [^_]É$M$ܧC$UVSu^@4$x [^]0҃{ 4$4tI4$t$ |4$Ey4$t&4$뙉4$y뤉4$:UVSu^@D$D$l$ CTCCC CCUV$ЈCUFDٴu[^]:UWV}S$йEh[]tK==='=t&A=t&>$ݹy=[ &de&>$)=;='t&-c=0=:t&>us$$ ===t&>u3$&A  D$$9Eh[]I=Xe=Dv=Et&u$R == =u$e$u$==J$=3$=&$=$Ǻq=Y=$غO$C$7$+$$"$3$B{$U$]$q$$$$$ǻ$׻${$o$c$ W$K$+?$:3$K'$]$lUVS]C$s@$k$1҅x [^]Ã~ F+$9 D$r4$>9( E@<UD${$>M9$<>UDžDžDžDžDžDžB<D$$D$D$D$ D$D$_t MA<t E@<t UB<t MA<t E@<Eu h$|U0 J< $D$$ ;)MAu MA<:ED$a$t2U9MA<;MA< EMA<UVSu] \$4$31҅t u[^]É4$US$EE] EttD$ED$D$ED$ D$ED$$1҅ttE E$[]UVSӃމT$D$$pJغ颋.$)T$)^$ )\$ [^]UWVS,}$<t ,[^_]ÍD$D$$ӾD$<$vG$Ɖ\$<$vo$t$É<$R.t$ xC< <?$"X$':/D$2YCuBD$$G$D$TYCuBD$$GD$eYCuBD$$GD$vYCuBD$$GD$YCuBD$$GD$YCuBD$$G\D$YCuBD$$G4D$YC uBD$$G D$YC uBD$$GD$YCuBD$$G$ .-D$CYuBD$$GD$YC uBD$$G`D$.YCuBD$$G8Ct(D$YCuBD$$G D$Y{xBD$$GD$HYC@uBD$$GD$YCuBD$$GD$_Y{xBD$$GjD$pYCuBD$$GBCt(D$YCuBD$$GD$TYC uBD$$GD$|YC@uBD$$GD$YC uBD$$GD$YCuBD$$GtD$YCuBD$$GL$ *D$CYuBD$$GC$ *CD$$@^ D$ٿD$CYuBD$$G豿D$YCuBD$$G艿D$YCuBD$$GaD$8YCuBD$$ 9D$YCuBD$$GD$\YCuBD$$GD$YCuBD$$G$ 3)CfS ¸60CfS ¸JCfS ¸^{AfSC ¸r{C S D$$ЉD$C<<CfS1$s ҉T$н;.|$$賽FfV$u ډ\$菽F$$`^ D$lغ.$T$P^$ T$6;g?$fSCC S D$$ЉD$D$CYuBD$$G込D$0YCuBD$$G薼D$dYCuBD$$GnD$YCuBD$$GFC .D$YCuBD$$GD$YCuBD$$GD$YCuBD$$GĻCD$$ ^ D$蛻CD$$`^ D$m3$ CSD$$ЉD$7C*UE]BUW}VgfffS)ˍ )ω)ʍ 4 [)^ ω_]UU)E )EMY… Шt ]Áf]UWVS}j|rk)t؉ )il]𻵁NEE))؍] C1r- S[^_]Í^=ǯwWfk)t؉ )ilf]𻵁NEE))؍f|U 1BB[^_]Uk)tWMVu SN )iǔ))V))N[^_]UVS0]u xB~7E4$D$ED$Et$D$ E$TD$0[^]ÍE$D$FED$E\$D$ E$D$袸념UWVSLDžU$}t E$GDžDžt DžD$D$$It DžG$<$荤D$U T$ T$<$D$+1t G<$D$U T$ T$<$D$G(o$uMSօuz~ ] \<$B)$<T$D$jLG(SօtFt$$D$0L~k] uFD;$?;E U T$UD$D$8T$ $觯G$tUL1[^_]Ão$1ȋED$x$D$TO9ED$$D$0뎃o$끋UD$$T$ t ~AE$t U$EtfD$D$E$tG$<$̡o$D$U T$ D$E<$D$iG(zEtfD$D$U$G$<$_o$D$E D$ D$U<$T$w(]tfD$D$E$蚮G$<$o$D$U T$ D$E<$D$菽[O(U tbD$D$U $-G$<$腠o$D$E D$ D$U <$T$"lG(ucL[^_]ÉED$$D$$<$,?)‰T$E$<D$HZ<$?)‰T$U $<T$Hq<$>)‰T$E$<D$H<$>)‰T$U$<T$iHCUD$$T$$DžED$$D$DžUD$$T$ЫDžXED$ $D$覫DžqUWVSu]}~UFt#FFFxЈV F F C$$jC$tFC$@|$ $<D$Et$$D$x [^_]ËC$C$$ k$@D$ $<D$Et$$D$袽yK$t 1[^_]ËE D$\$D$聪ED$t$$&F1UWVSà U@H @M 1уw1׹эAD$CHT$$1҉уwйэAD$CMt$$|CLCQ [^_]USËEt t:t u[]%UBЉ< v B<w Bȉ]ÍB1<wBUW1S1уv&z8DQt DAu1[_]~r$[_]UWVSӃ ut2t+ƒ%t:u)_t?u [^_]á$ D$0 D$‰$Cơ$ $%D$0 D$UVSÍ@$S}X ufF8[^]fF8$/}fFBC$ }fFDC$}fFFC$}fFHC $|fF:C $|fF VSDžlDžhE]Hp1fxlD$U$t1D$ D$D$$`> 1tzt<$p=Z 0EU D$ D$ET$$ÁĬ[^_]Í[U^ D$ D$8D$ $"뛃tA$`> y=j$d> y=t$d> x=@$x> x|$ D$ $z> t$ADžtz> Džd>  %t d t$fxu͋t$PxD$ D$<$T$d$)xx|$ D$D$$uƅxd$wh\1Džl$<$l'p/xh <<y~ $pt$UwD$ D$<$T$#d$.w|$ D$D$$}Džlnx$qU p$`UWVSTDžhD$$t1t ` ȺB)Rp))lt}D$\L$ D$<$=}uFhp9hulDžhD$ D$T$t$$H`TPDdTU }$UxET1ҋEAEAEA EAEAEAEĉAM؉`< t~鸒ut+.1҃`< t`~x<$ dB@t$Tļ[^_]UWVSLD$$1>ut$H^UX pDƉ$FFF FFF^@F|$ D$,D$$g<$L[^_]UVSu$tvDC@C 8t$ك[^]UVSÃC@4$D$:t[Du1[^]Ã[^]UWVS uUHXHtVEu$U + 1[^_]É؋U x.tԍ@ <$D$y؉E [^_]1*.tXHUWVS }UHXHtzEu$U 1[^_]1} @. у $U غ@. .t@ 4$D$؉E [^_]1|.{XHfUWVS x$T^\D$TD$$I XD@> H9}Y 9}H^ uꁸ^ ,tދU\$ |$D$Y$^ 9t@> 9|[^_]U1WVS,E}} щMы@> )M9}vEEEE9}O<^ u⋇^ 8t׋E$@. D$K^ tL]@> EE9|MUIL$ T$U $@. T$^ ,[^_]èuhU uZT$ UD$\^ D$E@. $tJD$$@.  aE苌^ mY럋^ $@. D$s뱋M$@. @. L$Y1уǁ@. /.ApǁD. pleDǁH. oublǁL. e/.PǁP. arenfǁT. tOU1WVS}} щMEыT)M@> 9EEEE9>^ uދ^ 8tӋE$@. D$h^ @U tYT$ UD$\:^ D$E@. $ZD$$@.  uM9T @> EE9OEU MD$ D$T$ $^ [^_]ËU$@. T$v^ E D$ vD$\0^ D$E@. $芤MU vL$t$ T$$@. 0^ M9TO[^ $@. D$ Yt^ $@. D$ 뉋E L$|$ D$$@. U:^ MTU1WVS,E}} щM@> )M9EEEEEEEE9a>^ u֋EUD$$ ^ 8^ 8^ E U܉D$ D$\:^ D$EE$MD$ $E^ e^ D$ E D$ED$\E$莢]^ uMD$ $'>uE^ bExwM E|$ D$L$$U:^ $. u-@> EEEE91,[^_]É$( $. 뿋ED$$ E.xNjUD$D$`> $6 . ~yED$$U$. $ $. nYZMD$ $ nU ^ T$ $. $k ,M $UWVS]Eƒ.uS1Ʌ.1Ʌ=`N } 8 8 8f 8H8* 8 Et|8 8 88EEt@ 8X8:E u E@ 8 8)8 18 <8 8r1W8T I86Et@ T8  8Et@ <8`8EtrD$:$Et[WNju8tcp u8tFJ u8t)Eti8t1Ƀ[^_]C. C z8t€}%8t#US]D$D$ $ۗTRD$^ D$ $诗HD$ D$$萗C)D$ D$$tHMD$D$ $RHHD$D$ $0[]UWVSUWVSLuE]H$+ ~ th=Z -E D$ t$D$E$ÁL[^_]Í[^ D$ D$8D$ $ő례uuEU $Eըu5tEۉ$_$[bG0j$~붍E׉$V_$*bG,EUSUt7ǂD $P$B][]5[]U,. u%0. up uz$$UEtD$$GB ՉEƉUWVSLDž]E f@> 11^ |u ^ |p `N <. >tC$>t6$+(p `N @> <. .u4. 8. $G0. @ @ 0. @ @hZ 0.  pt! t +hZ ~0. dZ x  t! t +dZ ~0. @fPE8u,. L[^_]ËUD$B $}$GDž,. D$T$$@. D$@. D$$}.t=@. #.t98. $zFD$@. Ípx @ t$|$ D$(C D$dD$$C D$ CD$CD$CD$$ U D$T$$蠍$T$D$$8. ;D$,. $,. _$ N$@. CGF1fCK*t2t6<. 9~У<. ,. 8. 8. Buʡ0. $0. ЉD$,. $,. /$ $ ${rUWV1S|E]}UD҉UMHM$x> YE$d> Y;uEE(. $MEUE $UEU|[^_]ÍG$SY}`> $8Y$H\UB,C$Y$/\MA0EE 9E}T<$X wt&$D=Z %D$ ED$U T$E$ƒ|[^_]á(. G $XE`> EE9E|ҍw4$uXÍG $eX\$`> D$E$4$EXEƋE9E1냍G$&XMMA@G$XUL PD$Ѓ$uEE9EG$WMMADG$WU< <U~ $= .  |1[^_]$`> QW=u$d> >W=t$d> +W=u$x> W1ҘE@C; . A$CA\$(. D$z> $Uh$U EUNUR^ D$ MD$8D$ $u$sV$GYUB,C$ZV$.Y6$JUWVS usDH> $> p> f>  ¡X fS8$> U$XC,$> U$XC0a> <wЉ$غb> v$> {UC@$> lUCDC@dždžLdžPD$F$~CDLJC@LJP耉LD$G$~E [^_]fS8$> TfC:$> TfC<= . ~p=> ug=> u^a>  uJtF=b> t=1҃b> t*91Ҁ> t> t~S 1[^_]$lUWVSEH$E?y=Z ,D$ ED$U T$E$[^_]ËUR^ D$ UD$8D$ $l뜉4$mS=ht$>Sf=\{$/SG,/_tF($SG,tF4$RG0UD$U ~TGDǃLǃPD$C$!|E[^_]|=wǃǃGD$TUW`> VSDžPDžLE]H\1fxP󫍽hUD҉XMD$ $t"D$ D$D$$`> $d> ~QHtIt<$>=Z ME UD$ L$D$$Áļ[^_]Ãt7$`> Q=uHH Ш{$x> P|$ D$ $z> `D$FuDžPDž``DžTDždz> 9Ld$sP $l[U^ D$ D$8D$ $%H+H>u>h$P$S\B,l$O$R\A0T`d 9T/<$P3\xpL Q<I<y~ $\` $ zvg1Ht DžHd$ND$ D$<$T$d4$Nh|$ D$T$ $)oDžPd$zND$ D$<$L$Dd4$LN|$ D$xD$$uƅx4$NL@d$MX\BDd$MXLPD$ȃ$D$D$&D$D$D$6D$\T$T$d$c\B$D$d$2tZ ~)D$  \D$H$T$`uL UWVSLpN =Z E\ D$D$Eȉ$ + E4?=`R N 40%;Eĉt}$E 1҉]+ =`R DƸtCG,ÉW4y 40;Eĉu+w_(EȉwD$D$<$'Jt.`R PPT$E $D$- E$轤`R D$D$$E]UpN {xS pZ x?4$Gx.`Z 4$D$ + D$[xڃL[^_]áZ 7`Z $D$D$_[.xɃ=Z E D$D$D$ $Z@)$I`R @8too @many@ fil@ es f@or H@FS v@olumf@eL[^_]á 4$+ D$<ED$tD$`R @8$v뱍ED$D$UWVES|D$TD$$lEEDMGREEBTFLE$fE@EE`R p X D$|$$ UՍED$T$ D$U$?doCD$$?C $D$?C D$$?C"$D$%t?C$t$$x?FD$C($f?C.$|$W?C2D$$1?Cx$D$ ?CzD$$ ?$D$>D$$>$D$x>}D$E$V|$$qU$T$_`R U D$E $D$fW>y.da $fUD$T$E$^.xҍUՍEEDTFLEET$ D$D$U$vbED$D$U$^x |1[^_]áda $|[1^_]áda $(da $UWVSE=Z }EƀUƀ@ ¡D ;E@EM4 MD$XE+@ ML$|T D$  $nƆƆƆƆƆAƆƆƆUD U@ ;E~VE)Ћ|T D$ $,e@ $f<C$e}AeUE0Eƀƀƀƀƀƀ9~σ[^_]á D$D$D$ $4'UƂƂƂƂƂƂƂƂƂƂƂƂ + Ƃ E@ @ D$D D$ $lZ@ D$<)EU|T D$ $hl$>UWVSDžLDžH] `R SA$҉TU B R(,HU‰@<BBKAߋ,)ljB ,((1 % @؋PDu1[^_]ËuFT$ UuY T$D$d$fT$$D$ D$uF$D$ D$D$$/=SPu Mtу urD$4$|$[-$, P$B$,Of$HO$$H $|$$dO$$   ‰D$ D$D$4$у D$|$4$:$,    ‰D$ D$D$4$у D$|$4$   ‰SD$ D$D$4$4 4$H   ‰SD$ D$>D$4$у> D$4$D$f ffSD$ D$D$4$94 jD$|$4$Y   ‰S D$ D$D$4$輿4 D$|$4$   ‰S$ .>C JDžD$ 4$D$T$31 $HK#D$|$4$   ‰SD$ D$D$4$c4 D$|$4$(   ‰S LD$4$T$!t $,f ff$ B.Džf9.kDžCDž DD$ 4$D$T$#31 .D$|$4$8.GW G   ‹A9ȉ,UWVSӃ u} $þ$軾4$賾} [^_]餾US]C$菾][]邾UWVhS !]D$$\$詾ƅh$t\D$\$SXhxuL$ D$D$$St$\$$蹻X@dA8$4\$D$$谽$dv0434$,4$x($f+d$X$Kd$H~>t:XAHD`40DT9`|19}Z19}M49}604049|9|119}C4D9 0,4(9|D$D$\$PD$D$\$Pɉ# X<$P4 $9 XP@ @9r@$X@ C E<$W@)‰SPZ <$6P4$(Xx+@<$)Ãu6< <  ШuD$ $G`.^< <  ШuD$ $螠.^< <  ШuD$ $O.S^< <  ШuD$ $ "u C"uCu.U DM$R $u&.EDžTDžP$$D$tD$$d/V$7螟D$ D$ D$$֡D$A$/D$ $臞D$ $hD$ $Iu$Y%5t$d$D$ $ޝ.D$ D$ D$$轠$D$,SD$r$-:UWV1S1҃t<[^_]À?uEU<[^_]ÍE<$D$+DŽtڀp€P Шt.E1EU*€x Шu$t딀t€T ШtSE1뾃9EȋEUeȉU܋UE؋]܋EUE̋MÉM]܋]܉]5g€G ШtEUSm€M ШtEU/f€F Шt0 iM0 eUs€S ШtEU k€K ШtEU b€B ШtEU w€W ШEUqUVSU EEËE ։ؙ1؉1 u E [^]É\$t$ D$$&+EE [^]UEUEyM QEUE]UE]f@ ИUM]Q Q Q UU E]UU MƈQ]UU MЈQAƈA]US]$bU []UVSu$GU f[^]UVSu$6U [^]UWVES}uD$<$s]19uE 17F[^_]Ë\$D$E $pE 7F[^_]USE ]D$$[]USE ]D$$[]USE ]D$$[]U1WVS } u}1˃4$Ӄ9!ÉD$RU \$$T$藜)D$$D$-> [^_]UWVS]\$ߚ$觘@ E$蹝t/E} E؍E$跚U)‰`a \[^_]`a \[^_]U`a t Eɍ%|j`a E%|US`a ]=t)ÃOڃ[]/`a )ÍOڃ[]US`a ]=t)ÃCm8[]`a )ÍCm8[]UVS]u t.t7`` `` )‰uuҀ>u1[^]Ät>t1ꐐUS$(襘@E CC ECCǃǃǃǃǃǃ ǃ$ǃ`ǃdǃhǃlfǃǃǃǃ fC$J1$2f{DBK4C$<$Jp$JC(C fC(] ǃ $t ] ] []C0 S<TSS$eyda }1[]É$w~x C(b$+y$]da : 뻉$yda lUSE$TyxAEt$DFx0uED$$Oyx1҃[]Ã[]US] $x$u[]U] .u]UVSut7] CF4$D$}t$u1[^]Ã[^]á] [^]UE]] USE] $Jxx_E$FD$'UBЃCB0B4C BDB4C$B $eC(E@$$T1҉C,[]USMpt ttttp9t $`[1]É $J1[]UWV(Sl*DžD$:E$荒 1}уA U Dž҉DžDžEEEEEEDž $ * ? MA(@1 fDžDB$ $ )1fDžfDžfDžfDžf DžGȋExL1҉ȋfЍf)}f|$$u}G,Dž(G4׉,1҉fDž Dž$fDž0Dž4ffDž81DŽ<~fDž\fDž^fDž`DždDžt1fDŽhfDŽjfDŽxfDŽz~D$ D$$\UB,(Rd$BUBB$2MAA $NjEPx$҉VNMA Am‹} ‰GC W G CexteC nts CoverCflowCC(C,C-C@fCDCHCLfCPCTCXC\CdfCxC`1fDzfD|fDŽfDŽ~D$$6(ǃǃǃ$D$ D$\$QǃfǃfǃxfǃfǃD$D$$1fǃ$ǃ(ǃ,ǃ0ǃ4fǃ8fǃ:ǃ<ǃ@1ƄDK~$܎D$D$$蚒ǃǃǃf@FFcataF logF(F,F-F@fFDFHFLfFPFTFXF\FdfFxF`1fDzfD|fDŽfDŽ~D$4$s4,dždždž$D$ D$t$OdžfdžfdžxfdžfdžD$D$$fdž$dž(dž,dž0dž4fdž8fdž:%dž<dž@1Ƅ0DK~$辌D$D$$|dždždžfW@DžpUE=l*[^_]Ë}GZ$跏$誏}da sDž da OM DžA AD$$LDDžda ܊l*[^_]Ëoda 詊Dž K$蜎$菎D$D$$茎\$D$$7\$$D$pD$ $mDž MD$L$<$IoDžD$4$BDžda da $mUE$lx`ED$D$D$ D$E D$E$nh~+}uEU1da UE$ l1҅x EUSE] $kxEE19t8D$D$ D$\$$dd~ E1҉[]UVSE] u$kxPED$D$ D$D$E$d~$EtE4$D$6Đ1[^]ÁĐ[^]UWVES] $ k1҅xZ$x.U;uO@] lLJptu[^_]Ép㍅HD$D$D$ED$ \$$jfHukP]GD$LJlD$Y$^D$t$$NRGt$D$Ep$H~LU<$t&裊da 脆1da h1 <$c1UWVSuFuG] tl9$uda [^_]ËF .tҍV$PF9|0FF V $$61f~tDV$V 0E{lD$<$QF9EuJHT$Cl$2WH F VF da F .HD$D$ |$D$$`.(D$|$ D$XD$D$$^.(U |$D$T$ $[$l1cF da G=E HD$ ET$D$E$[1US$E$Hg1҅$:@D$D$CD$ C(D$E D$E$c{(udEǃCxD$$r*ǃUuڃ$[]É$Gda (1$[]da  1 ߉$1UWVS Eu}4$~/4$3CHHE tE 1)sfFzt1)sf } t4$2xMt t9t(4$KE [^_]EiE몉4$E [^_]UWVESEu $,e]t@D$D$$]uՋt$]uD$$d+] t $$$t ] ;] ;] $cU[^_]É$D$\d[^_]ËKC1SC<B1 ) fJfff|$D$$蕄]C(MKPfCDʀuUfS(hD$$cE] $] f fC(UV1S]@tE $D$&[^]É$_,yܾUE]UWVS,E D$ D$D$U$&EE9v)ȉEutzϻȁ )9vD$ .D$T$E$&xI\$D$$UU)މuE,[^_]Á,[^_]UWVS<E }@8D$ <$D$D$%uuE<[^_]$1$G` )Ӊ9v;v/D$$7<$&\$$T$D$ c/D$<$T$M%x>)؉;v$da /}<[^_]UVSE ]u D$ D$D$$s$U92v6@u72$}$E9C`v1 [^]da |UWVES]}u D$ D$D$<$#t0~\&tIda 7|[^_]Ëx*E9v‰[^_]ËE؅ۉt1ҍt&UVSE$_xbdh]D$t$D$ \$E D$E$Z~)E\$t$D$ d$R[1^]Á[^]UUE D$ B(D$BD$B$R1UVSE$`^x}]D$t$D$ \$E D$E$0Z~FE@u(E$D$St$$$W[^]da z[^]US]@u!E D$C($US1[]da FzUSE$l]dhD$D$ E\$D$E D$E$1YxMdtCu*taE@uA\$T$$$_[]da y[]da ryda [yUVSE $\S8D$D$ X\$D$E D$E$LXXf^%2E@\$uȍT$4$OD$\$4$D\$Ep$8xqD$Y`4$D$OD$\$4$C\$Ep$c8xLD$ D$D$E$O\1҅x! [^]da w [^]da wda w'da wUWVES$ZS(D$D$ HT$D$UE D$$pV!/EP|pD$$0Ep@HPVىP@|ƅHƅIƅLƅM}E$LPE$;`TfDždDžhDžlfDžpDžtDžx$w$|Eً|EfE1fDfDfDfD~܍(}T$D$E<$Lt$\$<$At$D$H$CD$E\$p$2x,D$ D$D$E$XY1҅>yĜ[^_]da tda tda tUVSE@$W<@D$D$ `t$D$8E D$E$Sb`@<E@8EEED$$$ D$$$| t$<4$D$JD$\$4$?\$Ep$3D$ D$\$Ep$2yda rda erlUWVES$UQxD$t$D$ T$E D$E$MQ1x]xD$D$ T$D$EU$T$P9]t \9tD$:U$t8tw4$T$p1ɅAĬ[^_]da pĬ[^_]Ëtt1x Uh>uID$D$ T$D$E$NL.rU9uda B`da &;Mt$$/uD$D$D$ D$D$E$I.+UB?u:1уD$BF$tEHt$<$D$TFD$t$<$:t$Ep$4/.|T$<$D$E\$t$<$K:\$D$x$R<|D$t$Ep$[+.jxD$\$ T$ED$E$#J. D$$Cs\$$\J.t1ɁĬ[^_]Í4$D$da  mD$\$ D$ED$E$MI.JhT$$gr\$$D$$CrD$ xT$D$E$Q.D$ xD$D$E$P.1EUda ;lda al$qda BlRda P3UE]@.UWVS Eu} 4$x24$?x&S4EKD1fC.E [^_]ËS4EED1KfC.E [^_]UEU H]ÐUSE] HQ9v' AD$ED$$m1[]É9v A)da EkUSEU HY9v% QED$$D$Wm1[]É9v Q)UWVSE]u EC0}9vitt$SC<}։]EE [^_]da XDj[^_]da oUWVSE]u EC0}9ttIfc($j$BSC$C<ЃClKE}]E [^_]da i[^_]da ܐU1]UWVS<DžE@ Q$D$jD$$X$D$mD$$[$D$IQ AAA AAAAƅA @ B BB BBB!B%ƅ),$D$0D$$p4$D$^8D$$L<$D$:@D$$(D$D$HD$$L$D$PD$$TPXP\P ƅd`f=STttf=MP K u t{9vaT$D$U$8<[^_]da fda da ۋ,u"UBB<1[^_]da UVS0uD$D$4$D$$F$D$4D$$I$D$D$$$D$D$$$D$D$$$D$=REt*=KLt4$x1ҁ0[^]F fuF4$yda dUWVS<UE}pD$ET$$"T$$E$ D$E$$D$E($D$vE*$D$dE,$D$RE.$D$@E0$D$.E4$D$CE8$D$1E<$D$E@$D$ ED$D$EFD$D$$@9E11ۃdD$$Eh$D$iElD$$xEp$D$`EtD$$HEx$D$ E|D$$E耍D$$3DhD$$~֋|91D$$s$D$\$D$E$D$ODž$ÖD$\$$~-91D$$Dž$æD$Z\$$B~-91BUG BGexteG nts GoverGflowGG(G,G-G@fGDGHfGPGTGLGXBG\BGdfGxG`GzG~fDŽfDŽ~D$<$LJLJBTLJU1@cata@ log@(@,@-@@@fBDBHBLfBPBTBXBB\BB`BdfBxBzB~fDŽfDŽ~މ$D$kBXǂǂǂ1ҁ<[^_]^UWVS,]}uD$D$$bCLpGTCzC~FLGXFzF~UB$D$GD$$G$D$G D$$G$D$xGD$$hG$D$XGD$$HG$D$^GD$$OG $D$G$D$$0G($D$EFD$$D$*@9GH$1D$GLD$$GP$D$GTD$$GX$D$G\D$$lG`$D$GdD$$sDh$D$`~苅|9q$D$D$$$1D$D$$$D$D$$~ʋ-91$D$$D$OD$$8~ʋ-9upUD$$D$xUB uUωB1ҁ,[^_]ËB@ T$D$$\UBZUWVS EUx,@0B< )9|{ $wZE t$|$U$zxu؃ 1[^_]ËUu6Eǀ [^_]da HY܉$]da Y UWVS EUx,@0 t$|$E$(xu؋U1b [^_]ø [^_]ÐUE Uu>BzǂǂB~ǂ]Ëǂǂǂ]UVSUM ]uutBHtBLBzt[^]ÅtBTtBX.t卂U1҉WVS}E q9؉Urp)1҅>9)ƃ~D$ \$D$<$2~da pW[^_]ÍED$D$D$ <$ULJ1ۋBBEED$ ED$D$$UUWVSEU4u 4A841s4fFD$D$4e@D$D$ yMDL$4$Z4[^_]ËM@BBF4<S4Eʃ[^_]fF]f&\$ D$D$$//CMD8fǁfǁfǁfǁ|$ HhA@D$<$D$+t$\$<$ t$HD$E$*8D$\$4$D\$4$2uDD$4$2da SCDL$4$2da ǍDD$4$\2UWVtSD$ pD$lD$E$U1ҋH4ltdp;d/+d1ҋu1ҋ\`d9ljr2UM1ǂtBB9Dž|sW1ۋU9sD~߉Ѝx|$L$ $D$-E9pdu`tvn4[UDž;`)`D$$0MfDŽfDŽ`t ~u|xEf\$$.`x\$ E|$D$u4$+MtBB됋EDdD$U$x/Dž|U\$ D$D$4$P+ Ĭ[^_]ÁĬ1[^_]da 1Pda Uf)f)ffj)\)֋Uf`fhhD$$.da tUVS]Bu u 1Đ[^]CzfCDfCPfCxCt$D$D$ D$C$D$J)~C(t$$+x 뇸낐UWVSUEZ0dۉEt ;<t؉ED$ .\$D$4$~EU}U<$D$E <$D$E<$D$蒲E<$D$耲E<$D$萲E<$D$~UBf#wcT)UUUtE\p\$<$;u1҃[^_]da ,Mda Jda hUWVS}OdMOEt ;<E싐tȃMuGMD$4$蘲G 4$D$色GD$4$/G4$D$GD$4$4G4$D$$Gf#w{ЋMD)ED_4$D$uED$ c/MD$G $D$][^_]da PaLda Jda pUWVS}LJ$x50=u xt'da KĜ[^_]ÁuDK8$t$D$t$(D$t$,D$t$ܯ0D$t$į4D$t$謯8D$t$m:D$t$U<D$t$d@D$t$Lt\$$yf8$JJD$$8$D$LLJx_$D$YLڍD$D$$uLtWx|4$0=uSuGb$Ia1҉da nIt $t&cMda ct$HMda )I H.?$M2UWVSu9u trI0=ut1ۍ0$t$<$D$(D$<$,<$D$0D$<$ޭ4<$D$̭8D$<$蔭:<$D$聭<D$<$蔭@<$D$肭3D<$D$!K~D$0$T$$NJ$.|xx$e0=unubD$|$$Ix$xCo1ҁĜ[^_]da Fda U1҉WVSu$E 9@m9tD$$E4$O.8A41I <Ë@9‰<x$D$HFD$D$؉$ID$ D$t$<$<$8uo|DžfDžfDž<$xe9<#1ҁ[^_]Í$]E! t* $y޺[^_]Ë| $=da D UWVS]E D$$Cu~CDCtdxx$|<$xtUT$E <$D$uxZCxxU1uĜ[^_]=u!ED$U $T$d Ĝ[^_]da CĜ[^_]C<da  D$t$ |D$DdD$$U i$rUWVSL](xD$ D$\$4$54$4$;y|fǃ$(04ED$E 4$D$ xEuB,1ҁL[^_]Éx|x4$8y΍D$|$ |D$$DdD$D$\$D$ 4$.4$.a|f$(|$4$ |$D$4$E 4$D$ED$E 4$D$4$L[^_]UWVS]E D$$St5UT$E$D$i Ĝ[^_]ËCDC4x~dFd$膤x|$xsE|$D$ xU $T$;xOU1 x~d.TCtD$Ĝ[^_]da )(@Ĝ[^_]da D$UT$ CD$CDdD$$EUVS0Dž](4$D$ D$E 4$D$*$fw$f,0[1^]fuf$BdTd$Т(4$Rda B>0[^]fpfǃ$ǃ(ǃ0ǃ4UWVS E]} (Cu]da \>1 [^_]É|$$CuAC.xDCPdDd$C$y [^_]=u uda =zda =뵐UEU U@P@@ Uf@f@P@f@dEE E]AUWVS E0@tz<1ۃv1Mt#9v؋Mٸu9tTEߋX:1@ [^_]da <da UVSEH΃ 3@[^]UWVSEE}EGwrffEtiUETWLGU+MzdZdt;UEMfDW9މUtGtuWfUEE;EEUfTGfG[^_]ÃEE;EmUWVS u>^t&D^xdPdtE $D$1ɉ^ [^_]UWVS Uu ]p9tSt$$D$=ED$؉$UtU [^_]1{ %KFD$ $T$UWVSME uQEyƒfUDA\yȍT0dȍD0d9s()@B\yȍD0d9rAfEEfA9~DQfDQ9\yËUuDdU E[^_]vtFx $x|$+x1ҁ,[^_]ËE D$U$MD$] \$E$,[^_]Ë|4IUWVSE ]uE$Cf"wЋ>TSO)9~Eu]E [^_]|$E$D$5][^_]8UWVS} U]GLGBTBCL9d)Dd $T$D$9OuDGtC)tf~t*AufGЉtfD^fDWF9}֋UBG<$xsMA94tp]Ct=xx|$x6G$6xu4$E1ҋEĜ[^_]ËG4{UWVS]} CDCDd$xC |u"s$Ĝ[^_]Íx$ .xK1#DKS)u H6)9E|$$D$ xD$D$|$ CD$CDdD$$IEBUWVu S ]} 4$D$}CD$4$mC4$D$襙D$ \$4$赙EtU [^_]USE] $\$-CD$E$CD$E$OE\$D$ $^[]UWVS] u} $D$謘FD$$蜘F$D$טFD$$袘UtU [^_]USE] $\$cCD$E$QCD$E$腗E\$$O[]UxEȉD$E$ED$E $E+EtÍED$EЉ$̙U8ED$E$KE؉D$E $9E+Et‰UE)uEU)‰UWVu SE }E4$D$MGD$4$=~t&b}2uG4$1ۉD$GD$4$G4$D$%G D$4$G4$D$GD$4$G4$D$ÖGD$4$賖G4$D$裖GD$4$蓖G 4$D$胖G"D$4$sG$4$D$cG&D$4$SG(4$D$CG*D$4$3G,4$D$IG0D$4$G24$D$G4D$4$D84$D$~C1ۋD4$D$~G 4$D$וGD$E D$ $Mt E U+E[^_]G4$1ۉD$GGD$4$7G4$D$rG D$4$cG4$D$.GD$4$G4$D$GD$4$G4$D$GD$4$ߔG 4$D$G$D$4$G(4$D$豔G,D$4$ǔG04$D$踔G4D$4$詔G84$D$蚔GE9EQut E;Es-da @![^_]1E뷋U EMfBf Uf)BDfZ.E]49v ى؉M9wEHP1[^_]da !u!UWVE MS@fADӍ<ٸڃ 29wEHP[^_]UWVSLu Et ED$:4$:… ШU::4ې8MȍE9>wE9Bt:u1:1>:ƋEtU:ED$UT$UȋET$|$D$ U$UEx4˿)MUȉ\$t$$#D]  EȉD$CF$a$uE:x .D$D$ U|$T$U$L[^_]da L[^_]D$D$ U|$T$$q.~Et UB UED$UT$ED$ D$UB D$U$QL[^_]ÃEda  $LD$D$ U|$T$UJ1}t E1}uC1uP>da yUȉT$E$"1nda 7yUS]u%`u-u5t=][] $ `tӉ$ tˉ$ uÃ[]UUu ] t1da  US]CuD$Y4$D$ \$|$4$\\$H$D$cD$|$ $nx5D$ D$E D$U$1҅x l[^_]Ál[^_]UWVSUEEUtىغ8uE}~ƃ[^_]U1҉WVSEU°vUbMUJ@EUpx|/M1Y0t-؋!Ѓu؋MAD9tfqDI1ҁ[^_]Éx|x$.xDžh9|9|.#$NfDžtNj|.Et$BdTd$2ex$!.Dž9|9|.$fDžtNj|.TED$BdTd$\t cJV Ё[^_]ÐUVS ]D$$\$1҅ut%=t1ҁĀ [^]D$$01҅.xۍD$ $\$1҃.t.tƄ($D$4$U] uÉ$rÐUUE uR w $]ø]]t&UWVS E0DxtLfzt9(?&,D$ D$t$$TA AAÀ8.-<+<- ШtDP!DXt[Àt΋7Àu7DX t)7Àtɉu@9& B4!DX t)7Àtɉƒ>{<{!Y&i8x1@=!DX t)7ÀtɋzIzxt}D$ L$D$<$D$$B!DX t/0ÀtÉw\B89t 1~ՋO L$D$ <$}$| [^_]Éf@~>tAO @D$] $£] O D$pD$@$O DD$ D$t$ $G;-'& SDX bw$(Bdf ?&f{G눋Bm@9&D$ $D$\$D$<$G4fRu@u@u@؉GuI@ D$D$D$ $$t*@ !@^G@8|؃3ۉ)ʉWybbXÀVDX Bxq  .8ӋDP .!9\unv#709utr&Z Tz.J  bf ՃvxDžxdEp Y0CЃw` CЃwE  D$|$$2ËZ hu@ u@ Du@ DžUWVS } ut,t(C<^w)ED$É$-uԄu؃ [^_]ËE$\D$ÍP$pE$rD$뫋E$fD$떋E$vD$끋E$nD$iE$tD$QE$bD$k9%D$D$E$8UB w$1AD$ $tfA fA A A ‰QA A  ‰U1WVSLE;O .UčR] 4E ^ K 9MUEȋDE̋DEЋD EԋDE؋DE܋DEDEEtzF>%E 9E>wLUEȋDE̋DEЋD EԋDE؋DE܋DEDEEdO 9U}.MčI] fxntnEl9U}f8uE9U1L[^_]ËU 1)ڹ}ȅ. EMȉT$؉ $D$Mċ] ICEf{xC H$(]^C E]^S UEȉD$$aS#C4=tV&!&1Eȉ$D$ S#C4=u;EE1{uK)‰.[yQEH^tfQ>y;Ed^]ȍK M<H;E3x# #E;E#E0 D$D$D$ $\UčR] D9;E;EUO SUt.Zu%O t9tH@uZ1O [][]UO O M 9tP@u]Ë@1]UVSuO t$${t[u1[^]Ã[^]USO D$GB D$ $[uރ[]USE$y1tS؃[]UE]HU]U]Ua ]ÐU*E`{5Pk %@[ %@[u1ÐU]U]U$h ÐU]U]U$u ÐU]U]U$ ÐU]U]U$ pÐU]U]U$ PÐU]U]U$@ 0ÐU]U]U$` ÐU]U]U$ ÐU]U]U$ ÐU]U]U$ ÐU]U]U$ ÐU]U]U$ pÐU]U]U$ PÐU]U]U$@ 0ÐU]U]U$` ÐU]U]U$ ÐU]U]U$ ÐU]U]U$* ÐU]U]U$4 ÐU]U]U$< pÐU]U]U$ E PÐU]U]U$@N 0ÐU]U]U$`W ÐU]U]U$` ÐU]U]U$h ÐU]U]U$r ÐU]U]U${ ÐU]U]U$ pÐU]U]U$ PÐU]U]U$@ 0ÐU]U]U$` ÐU]U]U$ ÐU]U]U$ ÐU]U]U$ ÐU]U]U$ ÐU]U]U$ pÐU]U]U$ PÐUVSt$rt11 t$M~4$=[^]U]U]UWVS,DžMkE$?SD$B U$;1$GD$D$1 $r~Ƃ|$D$$nD$#$tD$l$D$ D$ u=wwADQDž|$D$$c<$Q4$D$D$$1 y\ppu$pD$D$$$ ~$tEE$S{CbCgC$a,[^_]É,[^_]11ᐐU]U]UWVS utt4$uht$$q>tQ$[t?4${ CCC4C9C] [^_] [^_]ÐU@ ]U(E D$D$$D$yD$D$ D$D$x1Ut3@ ~,D$$7uË t tU1]UWV1SEUE} EEPh~59~\$ދED$$"UBh)9}&)D$ED$E$~~9|ڃ[^_]ËUE[^_]UWV1S,}2)=}Í\$$ 9|ʁ,[^_]UWVSUEƉEE E9u5_hx2P> tN9uwɋU[^_]AEt+F ~ED$$D$kYČ[^_]ÍUD$P$FED$P$rUD$ D$ D$$~+VtugE1D$$*E$F ~(UED$T$D$ UE$D$蟁U)=~-E눉c0UWVSEEEE E1}эY\$E4$D${9t EEEE[^_]UWVSl}Wht8E uD$ D$D$P4$#ډt$$ Al[^_]UMQhtD$$ UMQhtD$ $UWVS,E] uHh1ɋ} u'1 u1 u~,[^_]Ë.x㋁tى\$ |$t$D$D$D$$E\$$*U1WVS}] Ohڅ u~ 1[^_]Ë1\$ H$D$D$1D$耂\$$9[^_]US]Clu$ChCltx u[]É$%҉D$A$D>[]U1WVS}Wh2E ]D$ D$LD$P$Ɓ\$$REPWh]9E|r9]E E $}GlČ[^_]D$\$ D$D$4$E-E=‹Wh9.wO ~D$D$Y$|}WhEGD$\$ D$D$4$UyfE-E=ƋWh9. W .D$D$f$|<$Č1[^_]ËE맋E%UWVSl}Wht8E uD$ D$sD$P4$ډt$$yl[^_]UWVS }Wht4u}u\2x u 1 [^_]ÉD$&$ËGhǀ4$SGh [^_]É$HWhǂ덉$1Whǂi$WhǂEUWVS]|EE$D$D$ D$P~E\$$TƉ$1tEt$$؃|[^_]U1VSuM ^ht t v 1[^]$tAta΋t6뼸 뵸 뮸 막$^h릉$^h뱉$^hUSd]$D$P$D$ D$ D$!d[]UWVS|}Wh_@G,CDžD$DžCD$C D$CD$CD$D$@D$ $}ƋC D$D$CT$5}s CHt$D$$s9t +~3D$D$$s;t $ƅC)CaC QC$AC(1 CLCL~-D$C+$$F1C>tt$$~1|[^_]ËC.=@D$D$${Dž^1C 됃 CL "UWVSDžUEr,@z Zƒ Шd[u^hM u D$:E $E pE hu D$D$t$ $BzD$:$|t |D$p$ IO ߅D$@$i)=v\$D$ D$D$$~ytE@ ~-|$O tT$ D$$D$v$p`$o8uO ۉl0]4$)D$D$D$ $Z$D$$tD$$$!u$IuFtu!Ĭ[^_]$YuL\$|$D$D$T$ $w볋UBttD$D$$w$ ‰Fh1.xBǂǂǂǂǂǂǂ$D$hׅnUBh8B t |oD$ D$D$P$v\$$ExgE hEEËE\$D$ ht$E$_UBhDžǀĬ[^_]D$$O $O 3D$H$r$rO tIDžpt$D$%$\rxDžl7YD$;$lrB$jW9t$FQ9tG$Tp$vCD$pD$O tT$ D$O @D$$uFtsD$pwD$$Wt$Kq%GD$$mD$+qD$$D$$D$$slD$/$tXD$pt$tD$ D$\$D$l$lt$$wpQ$@UUM tM UH]* t~ t1]ø1 UWVSE E ] tu t=U $T$UR xCD$ C D$C$D$a\[^_].tE볋EUE]JUVS] u\$4$P9É ШtˉNT^X[^]UVS] u~\$4$9} 1[^]Ë\$4$PFp[^]US]$PCp[]UE]J UE]J(UE]J,UE]J0UU EPd]US$]E$D$phD$ $etaD$?$Hzt $[]D$$'zuD$F$zuD$$y1҅t$UEP@B uJ$uz(u1z+t]UE]@@@UE@@Px@])Ë@]UWVSEYEuX@C(D$t$D$ E $pxe} )ǀ{(xi{)C(vL C(f%f=ET$ D$D$t$<$apx+U [^_]$@C)D$t$D$ <$(p.x)ƀ{)pC*D$t$D$ <$o.x)DE[J?85=+!Vk {UWVSE] uD$ D$\$E$hoxV}(UD$ UD$>\$<$9ox3)ÃyD$Y\$<$ox+U[^_]Ã[^_]UED$D$ED$ E D$E$3UWVSE}u X@C~Ct +E [^_]ÉD$CD$|$D$ 4$xn….xҋu C)փd~dD$D$|$D$ 4$….xUE@@P TD$D$ ET$D$E $kɉ!UWVS|EEux@G t:t*]D$ D$D$@$mڋMADt8tEEM T$D$D$ t$L$G$$tx9] )ËEt$\$$x)ƃ G(u+U |[^_]ËGLt$$D$ G+ED$.x)ƍG(D$MED$L$ t$\$$W.x땅<GMbD$EH`Y؍])‰T$D$D$@D$ $ZlMt$\$ $J.)U1҉WVS,}]G(~oG@@D$GD$G D$GD$GDD$,\$D$ E $kx,u )É<$Ɖ\$t$x)Ã(+U ,[^_]É\$t$<$.xƉ+U US]K|+St$L$)ЉD$&C|[]UWVSEu X@$NjC~Cu +E [^_]ÉD$C|$|$ D$ED$pD$4$j….xNju )Uփd~dD$D$4$D$ ED$….xUMbWVS}uG@@D$O`Y)‰T$D$t$D$ E $Qjx] )Ã(+U [^_]Ét$\$<$.xUWVS}]<$M tE 0t2G$~W(t'E<$D$ED$xq])EËG$~G(t7G@xt+|g@D$$D$ ED$}ix,)EG(~*E\$<$D$xÉ+U[^_]ÅyG$ɋED$$D$i.x)EG@nUWVS]Es${(C$C(D$ E $D$D$s${([^_]UVSEu D$\$$~D$\$4$\4$[^]UU$D$US]K|+St$L$)ЉD$ ED$ C|E[]US]$][]UVS]D$t$$~$D$t$$[$[^]UWVS }u]E D$D$D$>D$<$fyE Y} [^_]fUED$ E D$ED$ $UVS EX@$ƋC~Cu [^]ÉD$Ct$ t$D$ D$p$#fd~dD$$D$` [^]UMbVS ]C@@D$K`q)‰T$ D$D$ $e{( [^]]$ [^]\USEX@C~Ct[]ÉD$ CD$D$ $IeCd~dD$$D$[]UE@@P T$T$D$YUWVS }E u]D$D$<$dx'B^w/T$D$\<$dyE Y} [^_]dD$h<$}dUED$ E D$ED$ $[UWVSE] uD$ D$\$E$dxX}T$ D$\\$<$dx5)Ãx8EEB^vD$h\$<$mdyˉƒ[^_]D$Y\$<$Id.xۍ+U[^_]UED$D$ E D$E$qUE D$ED$ $UE]@@@(UVSEX@$n1҅tC+$F$.LF >Y>F$uF #F UEU t~ t~@ t1]ø U(E D$D$$D$0D$D$ <D$D$R1K1UWVSEPhEEEB EE}Ph17DZx$ZEPhfDZ~׃E}~ȃEm老}~>t"$$UBhǀǀ1[^_]UWVhS]t$$\$[ux%=`t 1ļ[^_]Ét$\$$ux%=XD$\$$y E1󫍅XD$$Et4D$$Dt t~ڃt&t-Uȅt&duBeu BvuB\D$C$=UD$$)UD$$UD$$UXD$$D$Z@=ƄXf1WX/I߹򮍽XʹэL $ \$$򮋅р|/D$/$@@X|$$D$PD$$X|$1$1tI.u B.uBuDŽ~ DŽ uDžt1t1򮋽tэ<9t~Ջtu Džtt=x91ƅH t1HfDŽ)G/D$H$4벉|$$h1uӃ $B=7HXƄHL$<$&X\$D$Y|$ $T U̹|ֿ t,|iuBdu BeuBED$ D$ D$$D$ D$ D$1)ЉEԃ$PD$ D$ D$1)ЉE؃$D$ D$ D$1)ЉE܃$M̙|1)ЉiuAdu AeuAt( |(׃B()1ɋph =N $<t%9uN!;u;u~pD$D$0$PD$|EЅu1||\$ D$D$$Op.dJhf|AT$t$ L$\$D$$^O L$D$ẺT$L$ D$D$Bt$[QXT$\$D$ D$D$NT$ \$D$Hu fDžH/$xPfTAq $Јq Qhr!r $Ȉr E 0EE  T$$T$D$ẺL$(t$ t$L$T$ D$D$$P{b||HQ҉:Dž(‰(‰҉Xщ $.XD$$i|sD$S1D$$DtB ~*D$lD$ D$$SOD$SD$ $#̉@ 򉍀~BL$T$t$L$ D$D$($N򉅌ǹ򮋅DM|\$ |$f/LADžUWVSEU@R EEUX@,E}ƒ} Шu~)4UBtFČ[^_]ËExhou tu t$U :}1}ED$D$D$ $UD$D$$T$ $߹EE%KE$D$ ED$ED$EMEEEUD$$dEx ~U|$ \$D$D$\$3La] t<u ttEx ^M t E 8Ed$IUB,$I$IE$荼EE 놐t&#ttt Ex vƋ >u\$D$HU$:KD$|$ \$D$U$Ko<$蘸b$ ׹UƉBh1.Ydždždždž fdždždž1E~ 1ۋEMph1ҍfDF~~m~U\$D$T$UD$T$ $JD$$;xtED$ ED$ED$E $EEUD$ E$D$ED$3EE!D$$IUBt>tU D$D$T$ $J1Uz >~"D$|$ \$D$$2IU$ UBtD$$HvU]U1VSU w5EXh1t)11ҍf|Cy~~1[^][^]U1VSM ]u u71 u&!EPhtDB[^][^]UD$8E@t$GUEP@hP $t1҅‰]U1U tBwE SU]遺]UWVSuF^@x{ ~C C$1ҁČ[^_]ÍExD$D$,$eED$D$@<$MECCDECtEC 1҅~DTD9S CEȋEċC@ƅ8iCD$S}ЉE܍ED$F$耹 Ct43M9t+EȋS9vЉD$L$4$諷EȋS9v)ЉCC xC(CE$EtCLxC+|C/EC3EC7EC;EC?ECCEC(CGE@tuC C( u,C$tb.+ƒ  к. DC$~ |$D$\$vEUЀ:uztC$UWVSU] t3rht0Rx9t%t~A tt;1[^_]Ã~ .t~ u߃[^_]ø>  䋶 .xQ)ڍRȹhЉ)‰T$ )ډi'U)É؉)L$ED$D$D$ $O DO 9US$] D$D$$D$6D$D$ YD$D$5$D$D$D$6D$D$ YD$D$4E\$$=$D$D$D$6D$D$ D$D$Rw4$[1]UWVSÃLUUu}xDЋM)‹E UttL[^_]ÍEMD$SD$ $螵1҅u֋C ~$ED$rD$ ED$$BED$SD$E$SẺUԉMЉE؁{ U~0D$EԉT$D$ EL$D$D$$@BEUM EԋUЉMtE܉.U؉EgUWVSEPhEEE9tLfDŽBE}17DZx$3EPhfDZ~׃E}~ȃEm䀁}~>t"$EPhǂǂtXxNfDŽBE17DZx$虮EPhfDZ~׃E}~1[^_]USÃD$$ı$D$D$譱[]UWVS<}Gh NBE EEEE1kUt$ T$U<$T$P$.x׍EED$r"D$$Ͳ.xE9E~ED$u"D$$覲~E}{E}cE ;EEEE1kUt$ T$U<$T$P$.x׍EED$r"D$$.xE9E~ED$u"D$$~E}{E}cEE1Ut$ T$U<$T$P$xcED$r"$D$舱xH_ ~6EUt$D$ET$ D$ED$8D$$>E;E}EqE}aE}I]Gh>yt6xW;t x ؃<[^_]ËU 9|U t&UWVS u} F ~|$D$$=!Í8$t1tFhVlډЃ [^_]US]Clu Cl[]É$Cl[]U1VSU w5EXh1t)11ҍf|Cy~~1[^][^]U1VSM ]u u71 u&!EPhtDB[^][^]U]US]Sh9CtAu3ED$"ED$C$x 1Ƀ}[]UWVSLE] PhpE9PtBE}D$"|$4$趮x1҅ttstKL[^_]ÍU1ׅEPEZttLMƒL[^_]E|$D$"4$;1҅yEt&׉T$D$4$貨USÃU$親‰U҉Ut ЉEED$"$D$íx[]$8[]UWVSP4|$D$$蕪x%=`D$<$蛫D$D$<$~XD$D$$$1V8Dž\$ CXD$<$D$轭t!谨 vtt  tD$<$D$[^_]UWVSLUE@h GxG xwxEEU؉D$ED$ED$ ED$ED$E܉$Mu MMw~Whrf f9tD$d$[6u܉؃E>u~_ ƉE܅~rEt$D$D$ $8u܁vN1L[^_]1ҋ_h9t%SfufSЃE.twU.xEE.xMȋ_hЍf|CEYMԅ-;uMȍfDCE؉$豥?frmǀ ED$"D$$蜪.*Ghu G,QD$)ڍRȹhЉ)‰T$ )ډi'U)øQ؉)L$ MЉ$L$V7;U  E;EU؉=GhU؉G1{U؉Gh'U؉MfLCUWVSDžPDžLUBJ Z=X\ƒ` Шu~+!MQtn[^_]ËE tUE tKqÃAuU BTu BAuBuDžLE MAhL`} tM 9uwX1\u]L1P1ۅ1P~ UBttPP~ UBttE M 91DžT} M D$ $'=7TډD$`D$D$\D$ D$X$El`UD$ \$D$XD$`D$\TD$Xډ$EL$ rEDžDpPx Hƒ Шu H"趢MAt>t*H|$t$ T$D$D$$4PEX DžTDž<UT1ۋBhHL$D$4D$ $3<1EPh7DBft0Tt$D$\$ T$D$HM$<3~~TtM D$D$L$ $Q313]u `U BaTGDžT8MD$D$L$ $e;ED$D$$D$ $sE1..D$4$x{`ډD$\D$ D$X$E.\Xy`PE.4tUBt>tD$D$$1.t.ttMAt>tt$ D$D$$1E$WEHh1f fAyUB ~&D$D$$0EHh>y ǁE t U :1 _HQ19`U|$ D$$D$ 0MD$ $EHPh>f\B$ 躞1ۉEɉHh.O1Lǁǁǁǁ fǁfǁǁDžT1T1fDŽQ12fDA~~ჅTT~`D$D$D$\$D$XD$ x/WUB,>tD$$.ME  D$ $  ED$D$D$ $`E1D$4$7dD$"$D$Ӡ7FڃaD$ `D$\D$X$Em\Xy`PEt 4OM ${UBt>tD$D$$.$뮋UBt>tD$D$$-ћ.z.p.f ])hDžHD$D$ D$$ÙhD$T$ D$$$蝙lDž@tƍFD$ D$ D$$蚜D$4$HSEDPhf\Bl@t @4uh $D~ UBtt} hM 9\H1.D$ $裝1} U Dx1 MAhHf\PL$ |$D$E$DDTUMBtu1@UBttM L$ D$D$$+΋MAt>tD$D$$w+c..UBt>tt$ D$D$$*+h $]KDU$fUWVS4Dž@4Džr@0~ 4Yh9AV4;P4t04Zh;,(4@ ~)FD$ D$D$4$)V~l4YhtV,(;~4ח [^_]ÉЃ$)(V$,_$FDž $$$$ D$D$$,$&,$  Q4AhQ,H61D2T,D $9|Fu),T8$9tFT$D$$D)~_$\$,T$0 $~9t!\$ D$4BD$$D$X%4Ah9,@ D$T$0 $TOFt",$;tFD$$D$(,B F F$z pFF)$F,x4B(~FB ~?,AD$A D$AD$AD$ D$LD$$&4P49Vt 01[^_]Í$F,xbF+N(FLD$D$,${'V$,F$ F F$yHAX<$4X ‹@XD$ BhD$D$$%4Yhw.F(8D$D$l$#F+8FDž@<DžHDžDƅVU$ЉڈF4x F+TFLTD$$(D$,$ &(,NDž 4$|~!4A`9|Mt@F H4B`uF(F$F "4Xh9H}F$F 4P40UWVSlEE]Cs@xChf~'l[^_]F F$1l[^_]Í}D$D$@<$!ESF>EF EFEFEEFTEF+EiFMEĉ|$D$"C$ NjC ~|$D$$K#iEԈF(E׉FLK ~&EډD$ ED$D$$#E؃vFE E$eC`U9}LF$F F tF$uF$E܉F1E1~EF 볉$~~C`uF(F 독ZEtV$uF$~+i~(_FLuFL~-~7u{~8uuF(F+FL' F$ƒ Шt ChfxCN$ƒ Шu RxxF(fǀGUEU t~ t~` t1]ø U$1U1]UD$${UD$$ZUYUA1U,1U]U1]U]U]U1]UU؎ÐUU EP4]US]C\uEC`uMC@uUu]ueChum$0Ctuu][]t$lC`t$]C@t$Nt$<t$*Cht$$軭Ctt$][]US$$1҅D$D$$@ D$ D$D$$CC4CL$蹍C\$袍C`tp$l菍C@t]$|CttJCxC| $$Ut $?څt[]É$1[]US]$$1[]UVSut5 $0迌t$$P趕t$$P$1[^]UWVS\DžDžE DžDžDžtE UP EC,Eƅt U:9t5 D$`$D$ D$D$$M1}U~4CD$C D$CT$D$<D$  $$D$赩څ\[^_]ÉTPuquVD$:$, u7+u~t$U$T$贎Ƅ5G<@D$,$諈W.1DžDžDžDžDžDž1:c]1ҁ\[^_]ËU D$YT$$uRCD$C D$ CD$D$ $gD$ D$D$TD$hD$ $ 덋BDžDžDžD$D$D$ D$E$D$蟌UEB<(<: ШtSD$:E$衆t6D$:$~. Uƅ D$U$T$EDžDžD$,$@E .D$wUT$E $<1E t Ct$R1<,iD$4$S8EԆE .kt$ D$ED$U $1H} t8D$D$D$D$ UT$E $m$D$8,E .tыD$D$ UT$E $B瀽DžDžD$E$D$ED$ D$UT$E $iA9. $D$0,„ Шt8t1G $D$]8u-(} .sD$D$ u .PD$D$ zUWVS]u }uUCs{ S[^_]ËE|$t$$D$ R$UsC{ S[^_]ÐUWVSME] ɋ}1t9tdu ~݃@MpU1u"9\$ D$ED$<$[^_]B;EuB[^_]É\$ D$UT$Ń .UEwN@ AED$@ D$ ËED$@ D$ 벋ED$A D$ = . UWVSEEEEEDž|DžxDžtDžpDžlDžhDždE,u $vu$4$E |$D$E${xσ [^_]UWVSEu} E t:E)Dž~/t$|$E$8u}t[^_]ËE[^_]ËE$UEEED$ED$E $1Ʌt;ED$D$E$x1ɅxET$$D$ÐUW1VSE] €  Шu+-Uu0E t"A< w30;E}} uދEtߋE 8[^_]ÍAq<< Ш.tω<w7W뤃 qE _E x€X ШSE cU E D$D$E$U ED$E$MU ÐUWVS$EE}E €  Шu+-Uu0E EE؉ULp;u}uE]ue]܉щEЉً]]EЉUEMԋUUt4A< vAY<€ Шtpvp;u|Et ]U]E UMH$[^_]Ã!EEx€X ШEU E D$D$E$mÐU$ s¸tEBE BQ Q 1USQ ]tB$D$RQ £Q u$ vUWVS u$ 4$q}$ … 1Ҩu [^_]UWVSÃL xN4$tbU T$UD$|$T$ $B u L[^_]É4$L[^_]ËE D$ U|$$B T$Eȉt$ D$B D$$oEwUEUD$E $16US] zU\$$1[]UEUD$E $US] 0U\$$¸[]UE D$B D$ ED$ $ ÐUVSM EUxt y؉ É ÉЉу‰~?yӃ~ [^]È[^]ÐUoÐUVSÃsP)‹ЃT$t$ $xsf[^]ǃsf[^]UM UAAff~]É]nUS$fDž EEE D$ E\$$P*D$$f~ E$[]ÉE$[]US$fDžEEEED$ E \$$P*D$ f~ E$[]ÉE$[]USU ]JAB~ []ÉJ[]US$E] $p+EE]D$ ED$ED$% ۉtEMxЃ$[]ÐUWVSuU M9 ШuaރyJ  ШumʉEыuڃ~sy[^_]ÃЃ[^_]␐UVSÃsP)‹ЃT$t$ $\xsf[^]ǃsf[^]UM UAAff~]É]nUS$fDž EEE D$ E\$$.D$ f~ E$[]ÉE$[]US$fDžEEEED$ E \$$.D$J f~ E$[]ÉE$[]UVSÃtK u[u1[^]Ét$C $.t݋S1t݋E D$CD$E$SUWVS ]u Njt]WtVttRډt$$aB t$$F?t .uu1uD$D$C $yg1\$$уL$VgD$D$$:gi [^_]ÐUWSE] R R R t= R t$GlE1}у  R R UE [_]@m $Hh£R uڃ[_]UR ]UR ]UR ]UWS R ]t=@R t$k1у w@R  R \$$l[_]É $g R uU R u R tuD UWVSÃLۉxA$tfUT$U t$ D$T$D$B E<$D$L[^_]ËED$U t$ D$B T$E<$D$L[^_]É\$ ]D$B D$$tUMEU L$ML$M $+US]U\$T$U $U[]ÐU%fUɉÐUSU ]JAB~ []ÉJ[]US$E] $p3EE]D$ ED$ED$%ۉtEMxЃ$[]ÐUE U]UE$3EED$ E D$ED$UÐUS]M … 1Ҩu8uu[]1[]ÐUSU] Mtaw3$C  utt []D$$T K1[]Á 볃 @ 먁  뚃  돁 넁  s hUWVS]}58^ tcuu>t$$F؃[^_]D$ D$D$$ctD$$d뭉 D$E $Qbxu1늋E $b1xUWVSEUB:EEBX~EUJuR$xM4$L$׃yED$E$׋UBtM$ L$׃yE[^_]USӋR ȃ uS []USӋR ȃ uS []USӋR ȃ uS []UWV}S_ 1҃ Ɉu_ [^_]UWVSEEB}EU1FуMV,M~ E+}~}t,~$ t&V(:tED$$V(UV(:uFuF$x؋U$T$UyF,t~$ tsE>E$0D$UmyUtMEL$$UUu^tM$ L$UyE[^_]ËV(:.tML$$V(UV(:uaF9)ȉEvUVSøC t1N؅x&ȋVx t  yF[^]CUWVS DžDžEU uDž%M $L$U<%u׍ƅ1҉DžDž DžDžà w$C Ĝ [^_]À*DžӃDBЉC< v݀.Dž$C |$]U$C |$]|$$C ]ƅIt)>$C ‰D$f]BCwC$C 0EEۉM9MɉUtE܉EEEUMHEU0^_É;}vUM̉UMEUEU0^_ǃEua9}w9urŰE)E܉ŰUtE܋ỦEUMEUQ녅u 1ƋẺE܉U= +EԉE؉MMM׊M؋U E̊ME̊M؋E ẺE̊MUe;ỦEw uE9Ev M)MȋEM̋E+EщM̉ʊMMԉE ‹EUEUWVS [ ~J E)19s׉M)F9Ήr [^_ÉUWVS[ñ  ) pNu. [^_ÐUSRW W  vЋuX[US[K PnQY[PREPPUBLAPPICOPYBIBLABSTVOLSVOLISYSIHFS_TYPEHFS_CREATORunixTEXTSTREAM.IMG;1TRANS.TBLboot.catalogLINUXCDROMnobakDo not include backup filesno-bakabstractSet Abstract filenameappidSet Application IDbiblioSet Bibliographic filenameno-cache-inodescheck-oldnamescheck-sessioncopyrightSet Copyright filenamedebugSet debug flageltorito-bootSet El Torito boot image nameeltorito-alt-bootsparc-bootSet sparc boot image namessunx86-bootSet sunx86 boot image namesgeneric-bootSet generic boot image namesparc-labellabel textSet sparc boot disk labelsunx86-labelSet sunx86 boot disk labeleltorito-catalogcdrecord-paramsPARAMSMagic paramters from cdrecordomit-perioddisable-deep-relocationfile-modefollow-linksFollow symbolic linksgidgraft-pointsDIRold-rootPrint option helpGLOBFILEHide ISO9660/RR filehide-listhiddenhidden-listhide-jolietHide Joliet filehide-joliet-listhide-joliet-trans-tblhide-rr-movedguiSwitch behaviour for GUIADD_FILESNo longer supportedinput-charsetCHARSEToutput-charsetiso-levelLEVELjoliet-longjcharsetfull-iso9660-filenamesmax-iso9660-filenamesallow-leading-dotsldotslog-fileLOG_FILEExclude file nameexclude-listno-padprev-sessionSCSIdevomit-version-numbernew-dir-modeforce-rrno-rrno-split-symlink-componentsno-split-symlink-fieldsSet output file namepath-listSet Volume preparerprint-sizePUBSet Volume publisherquietRun quietlyrational-rocksectypesortsplit-outputstream-file-nameFILE_NAMEstream-media-size#sysidSet System IDtranslation-tabletable-nameTABLE_NAMETranslation table file nameucs-levelSet Joliet UCS level (1..3)udfGenerate UDF file systemdvd-videouiduntranslated-filenamesrelaxed-filenamesno-iso-translateallow-lowercaseallow-multidotuse-fileversionverboseVerbosePrint the current versionSet Volume IDvolsetSet Volume set IDvolset-sizeSet Volume set sizevolset-seqnoold-excludehard-disk-bootno-emul-bootno-bootBoot image is not bootableboot-load-segboot-load-sizeSet numbers of load sectorsboot-info-tableXAxatransparent-compressionhfs-typeSet HFS default TYPEhfs-creatorSet HFS default CREATORappleAdd Apple ISO9660 extensionsCreate ISO9660/HFS hybridMAPPING_FILEmagicprobemac-nameno-mac-filesboot-hfs-fileSet HFS boot image namepartGenerate HFS partition tablecluster-sizeautoSet HFS AutoStart file nameno-desktophide-hfsHide HFS filehide-hfs-listList of HFS files to hidehfs-volidHFS_VOLIDicon-positionKeep HFS icon positionroot-infofinderinfo for root folderinput-hfs-charsetoutput-hfs-charsethfs-unlockLeave HFS Volume unlockedhfs-blessFOLDER_NAMEName of Folder to be blessedhfs-parmsPARAMETERSprep-bootchrp-bootAdd CHRP boot headernetatalkethershareexchangesgiLook for SGI Macintosh filesmacbinsingleusharexinetdaveLook for DAVE Macintosh filessfmLook for SFM Macintosh filesosx-doubleosx-hfsmkisofsUsage: %s [options] file... Use %s -help FROM: '%s' ESC: '%s' Cannot open '%s'. MKISOFSRCHOMEUsing "%s" Publisher string too long Preparer string too long Volume ID string too long Bad mode for -new-dir-mode %s:%d: name required System ID string too long Bad value for -uid Bad value for -gid /dev/nullMissing pathspec. Read error on '%s'. Bad mode for -file-mode Bad mode for -dir-mode defaultANSI_X3.4-1968iso8859-1mac-romancp10000%s linux-gnui686 %s (%s-%s-%s) Rock Ridge signatures found GRAFT:'%s' Joliet tree sort failed. Max brk space used %x %d extents written (%d MB) RRIP_1991Acan't open logfile: %s NO Rock Ridge present AA signatures found XA signatures found wbUnable to open /dev/null scan done Invalid node - %s Can't have -auto with -apple No pathnames found. Options: %s-%c-%s-%s%sIllegal Volume Set Size %s Not enough memory MKISOFS ISO 9660/HFS FILESYSTEM BUILDER & CDRECORD CD-R/DVD CREATOR (C) 1993 E.YOUNGDALE (C) 1997 J.PEARSON/J.SCHILLINGCache inodes (needed to detect hard links)Do not cache inodes (if filesystem has no unique unides)Check all imported ISO9660 names from old sessionCheck all ISO9660 names from previous sessionStart specifying alternative El Torito boot parametersSet El Torito boot catalog nameOmit trailing periods from filenames (violates ISO9660)Make the mode of all directories this mode.Disable deep directory relocation (violates ISO9660)Make the mode of all plain files this mode.Make the group owner of all files this gid.Allow to use graft points for filenamesSet root directory for all new files and directoriesSet root directory in previous session that is searched for filesFile with list of ISO9660/RR files to hideSet hidden attribute on ISO9660 fileFile with list of ISO9660 files with hidden attributeFile with list of Joliet files to hideHide TRANS.TBL from Joliet treeRename RR_MOVED to .rr_moved in Rock Ridge treeLocal input charset for file name conversionOutput charset for file name conversionSet ISO9660 conformance level (1..3) or 4 for ISO9660 version 2Generate Joliet directory informationAllow Joliet file names to be 103 Unicode charactersLocal charset for Joliet directory informationAllow full 31 character filenames for ISO9660 namesAllow 37 character filenames for ISO9660 names (violates ISO9660)Allow ISO9660 filenames to start with '.' (violates ISO9660)OLD Pre-POSIX.1-2001 option - don't use -LRe-direct messages to LOG_FILEFile with list of file names to excludePad output to a multiple of 32k (default)Do not pad output to a multiple of 32kSet path to previous session to mergeOmit version number from ISO9660 filename (violates ISO9660)Mode used when creating new directories.Inhibit automatic Rock Ridge detection for previous sessionInhibit reading of Rock Ridge attributes from previous sessionInhibit splitting symlink componentsInhibit splitting symlink fieldsFile with list of pathnames to processPrint estimated filesystem size and exitOLD Pre-POSIX.1-2001 option - don't use -PGenerate rationalized Rock Ridge directory informationGenerate Rock Ridge directory informationSet output sector type to e.g. data/xa1/rawSort file content locations according to rules in FILESplit output into files of approx. 1GB sizeSet the stream file ISO9660 name (incl. version)Set the size of your CD media in sectorsGenerate translation tables for systems that don't understand long filenamesGenerate DVD-Video compliant UDF file systemMake the owner of all files this uid.Allow Untranslated filenames (for HPUX & AIX - violates ISO9660). Forces -l, -d, -N, -allow-leading-dots, -relaxed-filenames, -allow-lowercase, -allow-multidotAllow 7 bit ASCII except lower case characters (violates ISO9660)Do not translate illegal ISO characters '~', '-' and '#' (violates ISO9660)Allow lower case characters in addition to the current character set (violates ISO9660)Allow more than one dot in filenames (e.g. .tar.gz) (violates ISO9660)Use file version # from filesystemSet Volume set sequence numberExclude file name(depreciated)Boot image is a hard disk imageBoot image is 'no emulation' imageSet load segment for boot imagePatch boot image with info tableGenerate XA directory attruibutesGenerate rationalized XA directory attruibutesEnable transparent compression of filesMap file extensions to HFS TYPE/CREATOROLD Pre-POSIX.1-2001 option - don't use -HMagic file for HFS TYPE/CREATORProbe all files for Apple/Unix file typesUse Macintosh name for ISO9660/Joliet/RockRidge file nameDo not look for Unix/Mac files (depreciated)Cluster size for PC Exchange Macintosh filesDo not create the HFS (empty) Desktop filesVolume name for the HFS partitionLocal input charset for HFS file name conversionOutput charset for HFS file name conversionComma separated list of HFS parametersPReP boot image file -- up to 4 are allowedLook for AUFS CAP Macintosh filesLook for NETATALK Macintosh filesLook for AppleDouble Macintosh filesLook for Helios EtherShare Macintosh filesLook for PC Exchange Macintosh filesLook for MacBinary Macintosh filesLook for AppleSingle Macintosh filesLook for IPT UShare Macintosh filesLook for XINET Macintosh filesLook for MacOS X AppleDouble Macintosh filesLook for MacOS X HFS Macintosh filesto get a list of valid options. %s:%d: equals sign required after '%.*s' %s:%d: field name "%s" unknown Illegal UCS Level %d, use 1..3. Boot image load address invalid. Warning: -follow-links does not always work correctly; be careful. The option '-P' is reserved by POSIX.1-2001. The option '-P' means 'do not follow symbolic links'. Mkisofs-2.02 will introduce POSIX semantics for '-P'. Use -publisher in future to get old mkisofs behavior. Warning: --osx-hfs only works on MacOS X ... ignoring Required Eltorito boot image pathname missing Volume Set Size > 1 not yet supported Volume set sequence number too big The option '-L' is reserved by POSIX.1-2001. The option '-L' means 'follow all symbolic links'. Mkisofs-2.02 will introduce POSIX semantics for '-L'. Use -allow-leading-dots in future to get old mkisofs behavior. Bibliographic filename string too long HFS default CREATOR string has illegal length. Copyright filename string too long Abstract filename string too long Maximum of 4 PRep+CHRP partition entries are allowed Warning: -no-mac-files no longer used ... ignoring Required PReP boot image pathname missing Application-id string too long Required generic boot image pathname missing Required boot catalog pathname missing Option -%c is reserved for future use. Boot image load size invalid. -i option no longer supported. Volume set ID string too long -stream-file-name not yet implemented Illegal iso9660 Level %d, use 1..3 or 4. -sparc-boot and -sunx86-boot are mutual exclusive. HFS default TYPE string has illegal length. Unknown charset Known charsets are: INFO: %s character encoding detected by locale settings. Assuming %s encoded filenames on source filesystem, use -input-charset to override. Unknown HFS charset Known charsets are: Warning: ISO-9660 filenames longer than %d may cause buffer overflows in the OS. Warning: Creating ISO-9660:1999 (version 2) filesystem. Warning: using transparent compression. This is a nonstandard Rock Ridge extension. The resulting filesystem can only be transparently read on Linux. On other operating systems you need to call mkzftree by hand to decompress the files. Warning: transparent decompression is a Linux Rock Ridge extension, but creating filesystem without Rock Ridge attributes; files will not be transparently decompressed. Warning: creating filesystem that does not conform to ISO-9660. Can't have both -apple and -hfs optionsCan't have -hfs with -sparc-boot/-sunx86-boot Can't have -hfs with -generic-boot Can't have -prep-boot with -apple Multisession usage bug: Must specify -C if -M is used. Warning: files from previous sessions will not be included in the HFS volume. re-directing all messages to %s Warning: creating filesystem with (nonstandard) Joliet extensions but without (standard) Rock Ridge extensions. It is highly recommended to add Rock Ridge Warning: Disabling Joliet support for DVD-Video. Iconv charsets cannot be used with Apple extension, HFS, ISO9660 version 2 or Rock Ridge. ISO9660/Rock Ridge tree sort failed. Implementation botch: %s should start at %u but starts at %u. Implementation botch: FS should end at %u but ends at %u. Done with: %-40sBlock(s) %d Writing: %-40sStart Block %u Cannot use XA, Rock Ridge, UDF or Joliet with -stream-media-size Cannot use multi session with -stream-media-size Cannot use boot options with -stream-media-size Cannot use Apple hybrid options with -stream-media-size graft_dir: '%s : %s', node: '%s', short_name: '%s' PLEASE CONTACT DISC PUBLISHER FOR SPECIFICATION SOURCE. SEE PUBLISHER IDENTIFIER IN PRIMARY VOLUME DESCRIPTOR FOR CONTACT INFORMATION.THE ROCK RIDGE INTERCHANGE PROTOCOL PROVIDES SUPPORT FOR POSIX FILE SYSTEM SEMANTICSUnable to open pathname list %s. Warning: -C specified without -M: old session data will not be merged. Disabling Rock Ridge / XA / AA Bad Rock Ridge signatures found (SU record missing) Can't have -hfs-boot-file with -apple The option '-H' is reserved by POSIX.1-2001. The option '-H' means 'follow symbolic links on command line'. Mkisofs-2.02 will introduce POSIX semantics for '-H'. Use -map in future to get old mkisofs behavior. Unsupported sector type '%s'. Panic cannot set back effective uid. Unable to open previous session image %s Unable to find previous session PVD %s Unable to open disc image file graft_dir: '%s : %s', node: '%s', (scan) Total extents scheduled to be written = %d Cannot merge previous session. Warning: assuming PC Exchange cluster size of 512 bytes Need either -XA/-xa or -R/-r for -apple to become active. Warning: no Apple/Unix files will be decoded/mapped GRAFT Point:'%s' in '%s : %s' (%s) DNJNfNJNmNQvNNAAUNNQNN"D]N#p]N]N$Q]NQNO&O*ObbQ8OVO^hOBBQsOO,QOOGGQOOOOP-OP8PccQH^IPCCYP`P~Pddh^R P^PDD^PP_PffPPP0_P\_͢P_PP_PPsWPQQQ`'Q P,`.Q QT`:QPFQWQQ`hQ`~Q`QQiiQQQQaQQ4aQQ\a?QJJaQ'aR QaRll,b(R`b>R.bQR.b>RLLbWR`Rc\UmmPiR{RQ0cR XcRcRMMQcRMRcRNNcR!PdR%@dR |dRdRdSooQSSQe2SppM'S;S0eUS/FSJSUSPPFS\e_SeSqSrrezSRReSss#VeSQfSPfS(S|fS)SfSUSSTTfSST TQ*TFTJTcT,gmTmT\gqTUUgT$hThhThT iTQTiTvvTTT|WVVUUUUU+US7UKUSxiXUxxQidUisUiUUUSiUSUUjU*@jU+djUzzj V#VV(VDV4VLVggRV>WhhoVVjHHVjVQkV0kV\kVkVQVVVW~k WQW.Wk9WPBWPWQ^WxWW$lWWWQWWQHlWQ|lWX X*X6XSX]XlhXQlrX|XlX m2YDmXlmXmXXXmXmX nX0nXX YY.YPn9Yn**BAD RRVERSION (%d) for %c%c Unable to locate directory parent call to search_tree_file with an absolute path, stripping initial path separator. Hope this was intended... Fatal error - RR overflow (reclen %d) for file %s Translation table size mismatch %d %d Unable to generate unique name for file %s Fatal goof, file '%s' already in hash table. Directories too deep for '%s' (%d) max is %d. Warning: missing whole name for: '%s' stat parent->whole_name: '%s' -> %d. Unknown file type (%s) %s - ignoring and continuing. Non-existent or inaccessible: %s File %s is too large - ignoring Unable to stat file %s - ignoring and continuing. Symlink %s ignored - continuing. Already cached directory seen (%s) File %s is not readable - ignoring Warning: Directory loop (%s dev: %lx ino: %lu). Directories too deep for '%s' (%d) max is %d; ignored - continuing. To incude the complete directory tree, use Rock Ridge extensions via -R or -r, or allow deep ISO9660 directory nesting via -D. PLCL%4d %5d %s %s000%s%sNEW name '%s' Using %s for %s%s%s (%s) Unable to sort directory %s %c %-*s%sfifochrdirblkregular filesymlinksocketunallocatedHidden from Joliet tree: %s F %s B %s %lu %lu S %s Hidden from ISO9660 tree: %s Hidden ISO9660 attribute: %s D %s ./.rr_movedHidden from HFS tree: %s L %s %s P %s C %s %lu %lu ./rr_movedoctal '%o'Ignoring file %s .bakExcluded by match: %s Path name %s/%s too long. Overflow of stat buffer Unable to open directory %s Scanning %s Excluded: %s Ending PadblockIntermediate PadblockThe File(s)Extension recordDirectory tree cleanupDirectory treeVersion blockEnd Volume DescriptorEnhanced Volume DescriptorPrimary Volume DescriptorInitial PadblockHFS volume header%s_%02dcannot fwrite %d*%d rbcannot read from '%s' cannot open '%s' VIDEO_TSCache hit for '%s%s%s' %d %d %s The pad was %d for file %s Entry %d not in path tables Predicted = %d, written = %d Total directory bytes: %d Path table size(bytes): %d ...ISODEBUGCTCMAX_XTCSIZECTC_LOOPTrying to write %d bytes (not a multiple of 2048). %6.2f%% done, estimate finish %sError: '%s' and '%s' have the same ISO9660 name '%s'. Error: '%s' and '%s' have the same Rock Ridge name '%s'. Directory size too small (. or .. missing ???) Unable to parse DVD-Video structures. Fatal goof - could not find dir entry for '%s' Implementation botch. Video pad for file %s is %d Either the *.IFO file is bad or you found a mkisofs bug. Unexpected directory length %lld expected: %d '%s' Continuation entry record length mismatch %d expected: %d. Fatal ISO9660 goof - directory has amnesia Unable to generate sane path tables - too many directories (%d) Path table lengths do not match %d expected: %d Total extents scheduled to be written (inc HFS) = %d Number of extents written not what was predicted. Please fix. Total translation table size: %d Total rockridge attributes bytes: %d Total extents actually written (inc HFS) = %d (Size of ISO volume = %d, HFS extra = %d) %4.4d%2.2d%2.2d%2.2d%2.2d%2.2d00Unable to make a DVD-Video image. Autostart filename must less than 12 charactersBNon zero-length file '%s' assigned zero extent. Checking name '%s' isorec.name '%s' '%s' does NOT END OK find_hash('%s') Panic: no space, cannot add RR CE entry (%d bytes mising) for %s line %d. currlen: %d ipnt: %d, recstart: %d Send bug report to the maintainer. Negative RR name length residual: %d symbolic link ``%s'' to long for one SL System Use Field, splittingAborting. TFRRPXREPNNMSLSL-path-splitAASL+SL++SL-rootZFSL-currentSL-parentExtension record too long 7SUDF Pad endUDF pad to sector 256UDF pad to sector 32UDF Anchor end volumeUDF file entriesUDF directory treeUDF file setUDF Anchor volumeUDF integ seqUDF second seqUDF main seqUDF volume recognition areaBEA01NSR02TEA01%08X%08XVTS_AUDIO_TSATS_.AOBUnable to locate relocated directory %02XISOREC:XA REC:BAD RR ATTRIBUTES:Disabling RR / XA / AA. SP%c %s Read error on old image %s CD001Should never get here Problems with old ISO directory entry for file: '%s'. Illegal extended directory attributes found (bad XA disk?). Try again using the -no-rr option. Found XA directory extension record. Cannot parse Rock Ridge attributes for '%s'. Warning: Neither Rock Ridge (-R) nor TRANS.TBL (-T) name translations were found on previous session. ISO (8.3) file names have been used instead. Special parameters for cdrecord not specified with -C Malformed cdrecord parameters Previous session has volume set size %d (must be 1). Previous session has incompatible sector size %d. -old-root (sub)directory %s not found in old session. Reading old session failed, cannot execute -old-root. Reading directory %s in old session failed, cannot execute -old-root. Joliet directory treeJoliet path tableJoliet Volume Descriptor%%/%cWarning: Iconv conversion not supported in conv_charset. Incorrectly encoded string (%s) encountered. Possibly creating an invalid Joliet extension. Aborting. Joliet path table lengths do not match %d expected: %d Fatal Joliet goof - directory has amnesia Error: %s and %s have the same Joliet name Unexpected joliet directory length %d expected: %d '%s' Fatal goof - unable to find directory location SccccSccccccccccSScccSccccccccccccccccccccccccccccSexcludedexcluded ISO-9660excluded Joliethidden attribute ISO-9660excluded HFSCan't open sort file list %s Can't open %s file list %s Can't allocate memory for sort filename Incorrect sort file format %sCan't allocate memory for %s filename .tar.gz.tgz.ps.gz.psz||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||Old session has illegal name '%.*s' length %d New session will use name '%s' Eltorito Volume DescriptorEmulating a hard disk No emulation Emulating a 1200 kB floppy No boot image specified. Emulating a 1440 kB floppy Emulating a 2880 kB floppy Uh oh, I cant find the boot catalog directory '%s'! Uh oh, I cant find the boot catalog '%s'! Size of boot image is %d sectors -> Error reading MBR from boot image '%s'. Warning: boot image '%s' MBR is not a boot sector. Warning: partition not marked active. Warning: partition does not start at 0/1/1. Warning: image size does not match geometry (%d) Boot image file '%s' changed underneath us! Boot image '%s' has no partitions. Too many El Torito boot entries Odd alignment at non-end-of-file in boot image '%s'. Boot image '%s' has multiple partitions. Error - boot image '%s' has not an allowable size. Error opening boot image '%s' for read. Uh oh, I cant find the boot image '%s' ! Error opening boot image file '%s' for update. Generic BootSun Disk LabelSun BootToo many boot partitions. Cannot access '%s'. Solaris x86sparcPartition %d may not have a filename. Total extents including %s boot = %d Cannot create sparc boot on offset != 0. CD-ROM Disc with Sun sparc boot created by mkisofsCD-ROM Disc with Sun x86 boot created by mkisofsCannot create generic boot on offset != 0. POSIXLY_CORRECT%s: illegal option -- %c %s: option `%s' is ambiguous %s: unrecognized option `%c%s' %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: option requires an argument -- %c %s: unrecognized option `--%s' %s: option `--%s' doesn't allow an argument Read error on old image Seek error on old image . %s%sCannot open SCSI driver. Cannot get SCSI I/O buffer. test unit readyrezero unitrequest_senseinquiryInquiry Data :read capacitySectorsize: %ld Bytes medium load/unloadprevent/allow medium removalstart/stop unitset streamingscsi_set_streamingset cd speedqic 02write_g0write_g1write_g5seek_g0seek_g1flush cacheread bufferwrite_bufferread subchannelread tocread headerread disk inforead track inforeserve trackreserve_track_rzoneread dvd structuresend opcclose track/sessionread master cuesend_cue_sheetread buffer capBFree: %ld K BSize: %ld K blank unitscsi_format: preparingformat unitscsi_format: running- [unable to fork()]mode sense g1Mode Sense Datamode sense g0Mode Sense Data (converted)SaveSet Mode Parametersmode select g1mode select g0Cannot read TOC header CD-Text len: %d wctbcdtext.datCannot read CD-Text header Cannot read CD-Text Cannot read TOC TOC data: ENT: B0 lout: %ld B0: B0 start: %ld tocheader: Session info too big. Pages: 0x%X Density: 0x%X Blocks: %ld Blocklen:%ld read_g1capacity_not_setread_g0Device type : Version : %d Response Format: %d Vendor_info : '%.8s' Identifikation : '%.16s' Revision : '%.4s' Capabilities : SOFTRESET CMDQUE LINKED SYNC WBUS16 WBUS32 RELADR TERMIOP AENC Device seems to be: Adaptec 4010Kodak PCD-600Sysgen SC4000Matsushita CW-7501Generic mmc2 DVD-R/DVD-RWGeneric mmc CD-ROMMissing Entry for dev %dPioneer DVD-R S101Plasmon RF-4100Emulex MD23Sony CDU-924SGeneric mmc2 DVD-ROMPhilips old CDD-521Ricoh RO-1420CPhilips CDD-2600Sony SMO-C501Adaptec 5500Generic NON CCS DiskAdaptec 4000Adaptec 4070Philips CDD-2000Maxtor RXT800SMatsushita CW-7502unknownBerthold HR-ScannerRicoh RO-1060CAdaptec 4000/4010/4070Generic CCS DiskAdaptec 4520AGeneric mmc CD-RPhilips CDD-521Yamaha CDR-100Emulex MT02Adaptec 4525Emulex MD21Microtek MS300APhilips CDD-522Yamaha CDR-400Pioneer DW-S114XGeneric mmc CD-RWGeneric CD-ROMTeac CD-R50ScaddythisTry to load media by hand. CD capabilitiesInquiry Data : RXT-800SACERCREATIVEGRUNDIGJVCMITSBISHMITSUMIOPTIMAPHILIPSIMSKODAKHPPINNACLEPIONEERPLASMONPLEXTORRICOHSAFSANYOSONYTEACTRAXDATATraxdataT.YUDENWPIYAMAHAMATSHITACDS615EBERTHOLDEMULEXADAPTECCR-4020CCDR2000CDD521/00CDD521/02CDD521CDD522PCD225KHSW/OBCDR-240CDD20CDD26C4324/C4325CD-Writer 6020CDR100IPWXR-W2001XR-W2010R2626CD-R 650ACB-4520ACB-4525RCD-1000RCD5020RCD5040RCD 4X4CD-WO DW-S114XCD-WO DR-R504XDVD-R DVR-S101RF4100CDR4220CD-R PX-R24CSRO1060CCD-R2004CD-R2006 CD-R2006PLUSCD-RW226CD-R4012CD-R CDU92CD-R CDU94CDR4120CD-R55SCD-WO CRD-R24SCD-WO EW-50CDR10CDR200CDR400CDR-632PCD-R CW-7501CD-R CW-7502 %s: %5d kB/s (CD %3ux, DVD %2ux) 162424 (I2S)traypop-upreserved(3)disc changercartridge changerreserved(6)reserved(7)CLV/PCAVreserved(2) Drive capabilities, per MMC page 2A: read CD-R medianot Does %s%s write CD-R mediaread CD-RW mediawrite CD-RW mediaread DVD-ROM mediaread DVD-R mediawrite DVD-R mediaread DVD-RAM mediawrite DVD-RAM mediasupport test writingread Mode 2 Form 1 blocksread Mode 2 Form 2 blocksread digital audio blocksread multi-session CDsread CD bar coderead R-W subcode informationreturn CD ISRC informationsupport C2 error pointersdeliver composite A/V dataplay audio CDsLoading mechanism type %s: %s Is %s%s support changing side of diskMaximum read speedCurrent read speedMaximum write speedCurrent write speedBuffer size in KB %s: %d Write speed # %d: MMC-2send digital data LSB-firstLength of data in BCLKsRotational control selected MMC-3Capacity: %ld Blocks = %ld kBytes = %ld MBytes = %ld prMB scsi_format: post processing %d Formating in progress: 0.00 %% done. Formating in progress: %.2f %% done [%d]. Formating in progress: 100.00 %% done. Mode Parameters (un-converted)Cannot load media with %s drive! error: %d scb.chk: %d sense_count: %d sense.code: 0x%x restart non-streamed digital audio reads accuratelysupport Buffer-Underrun-Free recordingread fixed-packet CD media using Method 2return R-W subcode de-interleaved and error-correctedread raw P-W subcode data from lead inreturn CD media catalog numbersupport ejection of CD via START/STOP commandlock media on power up via prevent jumperallow media to be locked in the drive via PREVENT/ALLOW commandcurrently in a media-locked statehave load-empty-slot-in-changer featuresupport Individual Disk Present feature Number of supported write speeds: %d Number of volume control levelssupport individual volume control setting for each channelsupport independent mute setting for each channelsupport digital output on port 1support digital output on port 2set LRCK high for left-channel datahave valid data on falling edge of clockCopy management revision supported:zD7Mb?/^]6]]YY] ATIP start of lead out: %ld (%02d:%02d/%02d) ATIP start of lead in: %ld (%02d:%02d/%02d) Mode Page DataCannot get default %s data. Cannot get %s mask. Cannot get %s data. Cannot get saved %s data. Mode Select DataWarning: controller returns wrong page %X for %s page (%X). Warning: controller creates hard SCSI failure when retrieving %s page. Warning: controller does not support %s page. Warning: controller returns zero sized %s page. Warning: controller returns wrong size for %s page. Warning: using default %s data. None.finderinfo/.resource/CAP.AppleDouble/Netatalk%.rsrc/EtherShare/UShareFINDER.DATRESOURCE.FRK/Exchangefinder.datresource.frk/.HSancillary.HSResource/XINET/SGIMacBinaryAppleSingleDAVE:Afp_AfpInfo:Afp_ResourceSFM._MacOS X AppleDouble/rsrcMacOS X HFS .finderinfo.resource.ADeskTop.IDeskTopNetwork Trash Folder.rootinfo.rsrc.Desktop.DeskServer.Label.AppleDouble.AppleDesktopRESOURCE.FRKDESKTOPFILEID.DATresource.frkfileid.dat.HSResourceDesktopFolderDB:Comments%RootInfo File type: %s HFS Name: %s ISO Name: %s CREATOR: %s TYPE: %s %4s%4s unable to open magic file%1snot enough memoryunable to open mapping filewarning: %s doesn't appear to be a %s file %s%*s%*1s%c%c%c%c%*1s%*1s%c%c%c%c%*1serror scanning afpfile %s - continuingTYPE_SGL error - shouldn't happen!TYPE_MBIN error - shouldn't happen!TYPE_ESH error - shouldn't happen!TYPE_DBL error - shouldn't happen!P0PPPPQ֮5XȯIcon%s %s%dUsing HFS name: %s for %s HFS scanning %s can't HFS close file %scan't HFS create file %scan't HFS create folder %scan't HFS set attributes %scan't HFS open %sBlessing %s (%s) Creating HFS Volume info can't HFS mount %scan't HFS format %scan't locate relocated directory %scan't find directory location %sDesktop DBDesktop DFPReP boot partition %d is "%s" Creating %d PReP boot partition(s) Uh oh, I cant find the boot image "%s"! unable to read HFS boot file %sunable to stat HFS boot file %sunable to open HFS boot file %sunable to read HFS boot block %s%s does not contain a valid boot blockunable to seek HFS boot file %sCHRP boot partition 1 Apple_HFSwith boot fileCreating HFS Label %s %s %s is not a HFS boot fileApple_DriverStream File Path tableStream File DirectoryStream File%s/VIDEO_TS/VTS_%02d_0.IFODVDVIDEO-VMGDVDVIDEO-VTS%s/VIDEO_TS/VIDEO_TS.IFOFaild to read VIDEO_TS.IFO Faild to seek VIDEO_TS.IFO Faild to open %s Giving up this is not a valid IFO file %s/VIDEO_TS/VIDEO_TS.VOB%s/VIDEO_TS/VTS_%02i_0.IFO%s/VIDEO_TS/VTS_%02i_0.VOB%s/VIDEO_TS/VTS_%02i_%i.VOBcalc: Can't stat %s Can't open device '%s' Can't open VTS info. Either VIDEO_TS.IFO or VIDEO_TS.VOB is not of correct size. %s/VIDEO_TS/VTS_%02i_0.IFO appears to be corrupted. Either VIDEO_TS.IFO or VIDEO_TS.VOB is not of correct sizeCan't open VMG info for '%s'. IFO is not of correct size aborting IFO is not of correct size aborting. %s/%s/VIDEO_TS/VIDEO_TS.BUP/VIDEO_TS/VTS_%02i_0.BUPCould not open %s Invalid domain for file open. /etc/cdrecord.conf,:/@%s=CDR_DEVICECDR_DEVICE=CDR_FIFOSIZEBad fifo size environment. CDR_SPEEDBad speed environment. CDR_SPEED=CDR_FIFOSIZE=Bad fifo size in defaults. Value %lld is too large for data type 'long'. not a Macintosh HFS volumevolume size must be >= 800Kno more entriescan't move across volumescan't use destination namebad destination pathcan't move root directorybad volume allocation block sizevolume name may not contain colonsvolume name must be 1-27 charsunexpected directory entry foundcan't move directory inside itselfcan't move above root directoryno errorshould not happen!read unallocated blockread nonexistent blockwrite unallocated blockwrite nonexistent blockbad partition mapcan't find HFS partitionunsupported block sizeunsupported partition map signatureunsupported start of partition logical datavolume bitmap collides with volume dataPossible Catalog file overflow - please report errorfile extents exceed file physical lengthfile extents exceed physical sizefile size exceeds physical lengthempty file extentread nonexistent b*-tree nodetoo many b*-tree node recordsread unallocated b*-tree nodemalformed b*-tree header nodeunsupported b*-tree node sizemalformed b*-tree map nodetruncated b*-tree mapunexpected b*-tree nodeb*-tree record already existsb*-tree record not foundempty b*-treewrite nonexistent b*-tree nodewrite unallocated b*-tree nodeb*-tree fullfree b*-tree node not foundbad thread recordvolume fullempty pathinvalid pathnameunexpected catalog recordno volume is currentcan't find parent directorybad volume bitmap or free block countQXNQOOONOONOOcont offset type opcode mask value desc~~~~ތ~~~h~~~~~~ތғ{bytestringbeshortlibfile: Out of memory. belongbedateString too long: %s leshortlelongledate%.3oHggHgLgngԕrԕ<rrBOINKcp437cp737cp775cp850cp852cp855cp857cp860cp861cp862cp863cp864cp865cp866cp869cp874cp1250cp1251iso8859-2iso8859-3iso8859-4iso8859-5iso8859-6iso8859-7iso8859-8iso8859-9iso8859-14iso8859-15koi8-rkoi8-ucp10006cp10007cp10029cp10079cp10081%x%xUCS-2BEREMOTE:rscsi@host:1,2,0rscsi@host:bus,target,lunREMOTE:Remote SCSIRSCSIProtocol error (got %s). Remote status(%s): %d '%s'. R%d A isatapiI initiator idT%d %d %d %d filenoB%d %d havebusF freebufM%ld getbufsndsize: %d rcvsize: %d D%ld maxdmacloseV%d S%d %d %d %d %d sendcmdREMOTE%.*sRSHdup2 failed. Illegal remote device syntaxO%s opentcpshellCannot create socketpair. /opt/schily/sbin/rscsiUnknown user: %s rshshell/tcp: unknown service setuid(%lld) failed. seteuid(%lld) failed. -lexeclp '%s' failed. Lost connection to remote host ?? locuser: '%s' rscsiuser: '%s' host: '%s' Warning: Using remote SCSI interface. Illegal value for busno, target or lun '%d,%d,%d'who are you? No passwd entry found. Cannot get connection to remote hostrcmdsh: fork to lose parent failed. {tm'''''''[I7yesYESstatus: 0x%x Reserved(%s%s) host adapter detected errorBUSYINTERMEDIATE GOOD STATUSRESERVATION CONFLICTCHECK CONDITIONCONDITION MET/GOODSense Bytes:Write Data: CDB: retryable errorfatal errorerror: %d%s: scsi sendcmd: %s Received Data: resid: %d DMA overrun, vendor specific %d unknown device type 0x%xRemovable not present unsupported reserved unsupported TapeWORMProcessorPrinterunit not presentWell known lunAutomation/Drive InterfaceObject based storageBridging expanderOptical card r/wSimple direct accessEnclosure servicesStorage arrayIT8 2IT8 1CommunicationJuke BoxOptical Storageunknown/no deviceSCSI ALREADY RUNNING !!INTERMEDIATE CONDITION MET/GOODSending %d (0x%X) bytes of data. SCSI command name not set by callercmd timeout after %ld.%03ld (%d) s Executing '%s' command on Bus %d Target %d, Lun %d timeout %ds Got %d (0x%X), expecting %d (0x%X) bytes of data. cmd finished after %ld.%03lds timeout %ds Cannot send SCSI cmd via ioctl ret < 0 errno: %d ux_errno: %d error: %d Currently running '%s' command. ƻлڻzm`SF9, scgo_send(%s) wrote %d bytes (expected %d). DMA (read) overrun by %d bytes (requested %d bytes). ATA Packet specific SCSI transportEXAMPLE: /dev/scsi/host1/bus2/target3/lun4/cd EXAMPLE: /dev/ide/host0/bus0/target1/lun0/cd EXAMPLE: /dev/hda or /dev/sr0 ERROR: in scgo_get_first_free_shillybus(...). Too many CDROMs, more than %iIncrease MAX_SCHILLY_HOSTS in scsi-linux-ata.c and recompile!ERROR: unknow subsystem (%s) in (%s) ERROR: this cdrom is already mapped %s(%d,%d,%d) INFO: subsystem %s: h %i, b %i, t %i, l %iERROR: with link merging! base %s link %s, result of merging %i ERROR: with link reading! link %s, result of readlink %i INFO: /dev/%s, (host%d/bus%d/target%d/lun%d) will be mapped on the schilly bus No %d (%d,%d,%d) INFO: Bus: %d Target: %d Lun: %d Chan: %d Ino: %d try open(%s) return %i errno %i calling sg_mapdev(...) Warning: Using ATA Packet interface. Warning: The related Linux kernel interface code seems to be unmaintained. Warning: There is absolutely NO DMA, operations thus are slow. errno (EACCESS), you don't have the needed rights for %s try open(%s) return %i, errno %i, trying next cdrom Illegal value for bus, target or lun '%d,%d,%d'try open(%s) return %i, errno %i, cancel INFO: scan_internal(...) failedNOT IMPELEMENTED: scgo_initiator_idioctl(CDROM_SEND_PACKET) ret: %d Generic transport independent SCSISCSI transport for ATAPI over Parallel PortATA Packet specific SCSI transport using sg interfaceBus: %d Target: %d Lun: %d Chan: %d Ino: %d Target (%d,%d,%d): DMA max %d old max: %ld Warning Linux Bus mapping botch. SCSI Bus: %d (mapped from %d) Linux sg driver version: %d.%d.%d Use of ATA is preferred over ATAPI. SCSI unsupported with '/dev/hd*'DMA addr: 0x%8.8lX size: %d - using copy buffer pack_len: %d, reply_len: %d pack_id: %d result: %d sense[0]: %02X Allocated DMA copy buffer, addr: 0x%8.8lX size: %ld host_status: %02X driver_status: %02X No remote SCSI transport available. Can't do %d byte command. ATAPI:1,2,0ATAPI:ERROR: unknow format INFO: %s -> %s srINFO: l1: 0x%lX l2: 0x%lX ATAPI/dev/cdroms/cdrom*/dev/hd[a-z]INFO: do scgo_open openbydevCannot open '%s'schily - Red Hat%d.%d.%dsgpgATA:scgo_getbuf: %ld bytes Cannot set SG_SET_TIMEOUT. Bus: %d cookie: %X file (%d,%d,%d): %d /dev/hd/dev/scd[0-9]/dev/scd[0-9][0-9]Cannot open '/dev/scd*'PP Bus: %d /dev/pg%dCannot open '/dev/hd*'/dev/pg[0-9]/dev/pg[0-9][0-9]Cannot open '/dev/pg*'ioctl ret: %d None.SCSI open usage error. Supported SCSI transports for this platform:WARNING: device not valid, trying to use default target... scsibus: %d target: %d lun: %d Invalid value for bus, target or lun (%d,%d,%d)Invalid bus or target specifier in '%s'Invalid target or lun specifier in '%s'scg__open(%s) %d,%d,%d HELPscsidev: '%s' devname: '%s' No memory for SCSI structureInvalid lun specifier '%s'Invalid lun specifier in '%s'No Additional SenseRecovered ErrorNot ReadyMedium ErrorHardware ErrorIllegal RequestUnit AttentionData ProtectBlank CheckVendor UniqueCopy AbortedAborted CommandEqualVolume OverflowMiscompareno write currentexcessive write errorsunreachable copy target tracking servo failure focus servo failure spindle servo failure head select fault block not compressible third party device failureread retries exhaustederror too long to correctmultiple read errorsl-ec uncorrectable errorcirc unrecovered errorincomplete block read no gap found miscorrected error de-compression crc errorerror reading isrc numberrecord not foundend-of-data not foundblock sequence errorrecovered data with retriesrecovered data with circrecovered data with l-ecrecovered data with linkingdefect list not availablegrown defect list not found!invalid element address!invalid address for write$cdb decryption error&parameter not supported&parameter value invalid&data decryption error&too many target descriptors& unexpected inexact segment& inline data length exceeded'hardware write protected'associated write protect'persistent write protect'permanent write protect'conditional write protect)power on occurred)scsi bus reset occurred)device internal reset*mode parameters changed*log parameters changed*reservations preempted*reservations released*registrations preempted,too many windows specified,persistent prevent conflict0cleaning failure0medium not formatted1format command failed2defect list update failure8esn - media class event;slew failure;paper jam;failed to sense top-of-form;reposition error; read past end of medium; position past end of medium;medium source element empty;end of medium reached;medium magazine removed;medium magazine inserted;medium magazine locked;medium magazine unlocked>logical unit failure>timeout on logical unit?microcode has been changed?inquiry data has changed?component device attached?device identifier changed?redundancy group deleted?spare created or modified? spare deleted? volume set deleted? volume set deassigned? volume set reassigned?echo buffer overwritten?medium loadablePwrite append position errorSunload tape failureSmedium removal preventedUsystem buffer fullUinsufficient resources[threshold condition met[log counter at maximum[log list codes exhausted\spindles synchronized\spindles not synchronized^Bpower state change to idle^Epower state change to sleepaunable to acquire videoaout of focusdinvalid packet sizegadd logical unit failedgassign failure occurrediparity/data mismatchkredundancy level got betterkredundancy level got worsesprogram memory area is fullsrma/pma is almost fullinvalid sense code 0x%Xvendor unique sense code 0x%X[]no sense, deferred error [No matching qualifier](illegal block length end of medium file mark detected (valid) (not valid) Sense flags: Blk %d %s%s%s%sinvalid sensekeyactual retry count %doperation %d%% done(valid)command(not valid) disk not inserted load/unload failure spindle failure focus failuretracking failurebias magnet failure#illegal function for medium type8recoverable write error9write error recovery failed:defect list update failed=defect list not availablelimited laser lifelaser focus coil over-currentlaser tracking coil over-currenttemperature alarmECC error during verifyinterleave errorbad format on driveself test faileddefective track#volume overflow+set limit violation,error counter overflow-initiator detected error.scsi parity error/adapter parity errorno additional sense informationfilemark detectedend-of-partition/medium detectedsetmark detectedbeginning-of-partition/medium detectedend-of-data detectedi/o process terminatedaudio play operation in progressaudio play operation pausedaudio play operation successfully completedaudio play operation stopped due to errorno current audio status to returnoperation in progresscleaning requestedno index/sector signalno seek completeperipheral device write faultlogical unit not ready, cause not reportablelogical unit does not respond to selectionno reference position foundmultiple peripheral devices selectedlogical unit communication failure track following error error log overflow warning write error error detected by third party temporary initiatorid crc or ecc errorunrecovered read erroraddress mark not found for id fieldaddress mark not found for data fieldrecorded entity not foundrandom positioning errordata synchronization mark errorrecovered data with no error correction appliedrecovered data with error correction applieddefect list errorparameter list length errorsynchronous data transfer errordefect list not foundmiscompare during verify operationrecovered id with ecc correctionpartial defect list transfer invalid command operation code!logical block address out of range"illegal function (use 20 00, 24 00, or 26 00)$invalid field in cdb%logical unit not supported&invalid field in parameter list'write protected(not ready to ready change, medium may have changed)power on, reset, or bus device reset occurred*parameters changed+copy cannot execute since host cannot disconnect,command sequence error-overwrite error on update in place.insufficient time for operation/commands cleared by another initiator0incompatible medium installed1medium format corrupted2no defect spare location available3tape length error4enclosure failure5enclosure services failure6ribbon, ink, or toner failure7rounded parameter8event status notification9saving parameters not supported:medium not present;sequential positioning error=invalid bits in identify message>logical unit has not self-configured yet?target operating conditions have changed@ram failure (should use 40 nn)@diagnostic failure on component nn (80h-ffh)Adata path failure (should use 40 nn)Bpower-on or self-test failure (should use 40 nn)Cmessage errorDinternal target failureEselect or reselect failureFunsuccessful soft resetGscsi parity errorHinitiator detected error message receivedIinvalid message errorJcommand phase errorKdata phase errorLlogical unit failed self-configurationMtagged overlapped commands (nn = queue tag)Noverlapped commands attemptedPwrite append errorQerase failureRcartridge faultSmedia load or eject failedTscsi to host system interface failureUsystem resource failureWunable to recover table-of-contentsXgeneration does not existYupdated block readZoperator request or state change input[log exception\rpl status change]failure prediction threshold exceeded^low power condition on`lamp failureavideo acquisition errorbscan head positioning errorcend of user area encountered on this trackdillegal mode for this trackevoltage faultfautomatic document feeder cover upgconfiguration failurehlogical unit not configuredidata loss on logical unitjinformational, refer to logkstate change has occurredlrebuild failure occurredmrecalculate failure occurredncommand to logical unit failedocopy protection key exchange failure - authentication failurepdecompression exception short algorithm id of nnqdecompression exception long algorithm idrsession fixation errorscd control error%logical unit is in process of becoming readylogical unit not ready, initializing cmd. requiredlogical unit not ready, manual intervention requiredlogical unit not ready, format in progresslogical unit not ready, rebuild in progresslogical unit not ready, recalculation in progresslogical unit not ready, operation in progresslogical unit not ready, long write in progress logical unit not ready, self-test in progress asymmetric access code 3 (00-232) [proposed] asymmetric access code 1 (00-232) [proposed] asymmetric access code 2 (00-232) [proposed]auxiliary memory code 2 (99-148) [proposed]logical unit communication time-outlogical unit communication parity errorlogical unit communication crc error (ultra-dma/32) warning - specified temperature exceeded warning - enclosure degraded write error - recovered with auto reallocation write error - auto reallocation failed write error - recommend reassignment compression check miscompare error data expansion occurred during compression write error - recovery needed write error - recovery failed write error - loss of streaming write error - padding blocks added auxiliary memory code 4 (99-148) [proposed] copy target device not reachable incorrect copy target device type copy target device data underrun copy target device data overrununrecovered read error - auto reallocate faileddata re-synchronization error unrecovered read error - recommend reassignment unrecovered read error - recommend rewrite the datacannot decompress using declared algorithmerror reading upc/ean numberread error - loss of streamingauxiliary memory code 3 (99-148) [proposed]filemark or setmark not foundrecord not found - recommend reassignmentrecord not found - data auto-reallocatedmechanical positioning errorpositioning error detected by read of mediumdata sync error - data rewrittendata sync error - recommend rewritedata sync error - data auto-reallocateddata sync error - recommend reassignmentrecovered data with positive head offsetrecovered data with negative head offsetrecovered data with retries and/or circ appliedrecovered data using previous sector idrecovered data without ecc - data auto-reallocatedrecovered data without ecc - recommend reassignmentrecovered data without ecc - recommend rewrite recovered data without ecc - data rewrittenrecovered data with error corr. & retries appliedrecovered data - data auto-reallocatedrecovered data - recommend reassignmentrecovered data - recommend rewriterecovered data with ecc - data rewrittendefect list error in primary listdefect list error in grown listprimary defect list not found access controls code 1 (99-314) [proposed] access controls code 2 (99-314) [proposed] access controls code 3 (99-314) [proposed] read type operation while in write capable state write type operation while in read capable state illegal command while in explicit address model illegal command while in implicit address model access controls code 5 (99-245) [proposed] access controls code 6 (99-245) [proposed] access controls code 7 (99-245) [proposed] access controls code 8 (99-245) [proposed]$invalid cdb field while in explicit block address model$invalid cdb field while in implicit block address model&threshold parameters not supported&invalid release of persistent reservation&unsupported target descriptor type code&too many segment descriptors& unsupported segment descriptor type code& invalid operation for copy source or destination& copy segment granularity violation'logical unit software write protected(import or export element accessed)bus device reset function occurred)transceiver mode changed to single-ended)transceiver mode changed to lvd*asymmetric access code 6 (00-232) [proposed]*asymmetric access code 7 (00-232) [proposed],invalid combination of windows specified,current program area is not empty,current program area is empty,illegal power condition request0cannot read medium - unknown format0cannot read medium - incompatible format0cleaning cartridge installed0cannot write medium - unknown format0cannot write medium - incompatible format0cannot format medium - incompatible medium0cannot write - application code mismatch0 current session not fixated for append1zoned formatting failed due to spare linking5unsupported enclosure function5enclosure services unavailable5enclosure services transfer failure5enclosure services transfer refused8esn - power management class event8esn - device busy class event:medium not present - tray closed:medium not present - tray open:medium not present - loadable:medium not present - medium auxiliary memory accessible;tape position error at beginning-of-medium;tape position error at end-of-medium;tape or electronic vertical forms unit not ready;failed to sense bottom-of-form; read past beginning of medium; position past beginning of medium; medium destination element full;medium magazine not accessible;mechanical positioning or changer error>logical unit failed self-test>logical unit unable to update self-test log?changed operating definition?redundancy group created or modified? volume set created or modified?reported luns data has changed?medium auxiliary memory accessibleGdata phase crc error detectedGscsi parity error detected during st data phaseGinformation unit crc error detectedGasynchronous information protection error detectedPposition error related to timingQerase failure - incomplete erase operation detectedUinsufficient reservation resourcesUinsufficient registration resourcesUaccess controls code 4 (99-314) [proposed]Uauxiliary memory code 1 (99-148) [proposed]Zoperator medium removal requestZoperator selected write protectZoperator selected write permit]media failure prediction threshold exceeded]logical unit failure prediction threshold exceeded]spare area exhaustion prediction threshold exceeded]hardware impending failure general hard drive failure]hardware impending failure drive error rate too high]hardware impending failure data error rate too high]hardware impending failure seek error rate too high]hardware impending failure too many block reassigns]hardware impending failure access times too high]hardware impending failure start unit times too high]hardware impending failure channel parametrics]hardware impending failure controller detected]hardware impending failure throughput performance]hardware impending failure seek time performance]hardware impending failure spin-up retry count]hardware impending failure drive calibration retry count] controller impending failure general hard drive failure]!controller impending failure drive error rate too high]"controller impending failure data error rate too high]#controller impending failure seek error rate too high]$controller impending failure too many block reassigns]%controller impending failure access times too high]&controller impending failure start unit times too high]'controller impending failure channel parametrics](controller impending failure controller detected])controller impending failure throughput performance]*controller impending failure seek time performance]+controller impending failure spin-up retry count],controller impending failure drive calibration retry count]0data channel impending failure general hard drive failure]1data channel impending failure drive error rate too high]2data channel impending failure data error rate too high]3data channel impending failure seek error rate too high]4data channel impending failure too many block reassigns]5data channel impending failure access times too high]6data channel impending failure start unit times too high]7data channel impending failure channel parametrics]8data channel impending failure controller detected]9data channel impending failure throughput performance]:data channel impending failure seek time performance];data channel impending failure spin-up retry count]F>;;;;>;;F>;c?;;;;;;;;;;;;;;;;;;;;;?;;;;;;;?B<<<<0B<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< @<<<< @<<<<< @<<@@<<<<<bB< @<<<<<<<EBlB @AAiA]A @QA<@<@ @q@<@@1A<@<<GA< @; h<\|zR| $PAB E<T AB E\@AB E$  Mh Q W ȓ ohooZ,W Ηޗ.>N^n~Θޘ.>N^n~Ιޙ.>N^n~Κޚ.>N^n~Λޛ.>N^n~Μޜ.>N^n~Νޝ.>N^n~Ξ$W M M MZ M M M M MZ MZ MhZ MdZ  NNN!N+N8N>N\m@mkisofs 2.01.mkisofsrc&UbWTV8XBU_T^U:U1VšUVٚT?STPT>OTN T0bG'TEVA`RhG J1./؀wDZ#ok~Tw ffՎǣ{$ϧ T;@CEɪTR R  ȱ?AyʿܿYY,}#+#+t@$ ߚ|%YY%/ YY19 #+E JWe ii#+l ,AFP8  "#()*+,/0123456789:;<=>?@ABCDEFGHXZ^`gikmsuwy{THXZ^`gikmsuwy{LP\b}UJVLNP\bdefopqr}RWR&' JN$%-.ا<Zc a   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~g   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~bj h pu  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %t s r q p o n ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠhw u   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%e"d"H""" % ~ } | { ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~n    !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~#BVW+yM"Z[*{|z A%%%%$% c%Q%W%]%.`%%4%,%%%<%rjZ%T%i%f%`%P%l%} /ask~% %%%%%%LCD67;<FE   "%     ͺްЀӷ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~噞t  К՚  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%%%%$%c%Q%W%]%%%4%,%%%<%Z%T%i%f%`%P%l%1% %%%% %    ͺ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Ͼ󨷵ǎԐѥ噞ᅠƄФz@ @   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~oBPQy9:=>Z[deA }~z _%%%%$%^c%Q%W%]%{|%%4%,%%%<%Z%T%i%f%`%P%l%G% %%%bn%CDH`aTUpcqXY%@ @ @ @ ͺǤޅ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~` `   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~RSQTUVWXY Z [ \ ^_N.J*01F&45D$3%%%%$%E%8c%Q%W%]%9%%4%,%%%<%:Z%T%i%f%`%P%l%;<=>?% %%%O%/@ A!B"C#62L,!K+7H(M-I)G'%` ` ` ` ͺ쭧諶ࠢ묦窵  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  05  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~10^_%%%%$%c%Q%W%]%%%4%,%%%<%Z%T%i%f%`%P%l%% %%%%%   ͺ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ϾѮЯ󨷵ǎԐᅠƄ졌  PU  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ %%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %      ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠ  pu  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %       ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠ    !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %        ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~    !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %       ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  Л՛  !"#$j&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~""%%%<%$%,%%4%% %%%"H" `abcdefghi@}Q%      ¢åǨ%  !"#$&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ܡ@ @   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %@ @ @ @ @ @ @ ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠ` `   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%@ABCDEFGHIJKLMNOQTW^""!%` ` ` ` ` ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  05  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   %%%%$%c%Q%W%]%%%4%,%%%<%Z%T%i%f%`%P%l%% %%%%%    ͺՑ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  PU  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~&     "         !"#$%&'()*+,-./0123456789:?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[     !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!  pu  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   & ! 0 `9 Zd}y    "   "!a: [e~zA^{B_=>|T9 CGPXnpbU: DHQYoqc) ( ' & % 㥹  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~, *   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ S & ! 0 9   R    "   "!Y: Z\[_^VQ!TXUW !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNO3 2 1 0   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Z7 5   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~;   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ >  < М՜  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~A=Z`^dy}{B>[a_ez~|T9 CGPXnpbU: DHQYoqc D  C  B 㡱  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@G @E   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~&$0^4{'%1_5|  l\  !m]@M @L @K   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~`P `N   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~8V(;`"f}W)<a#gJ~K. *EL6rhj/ +FM7sik`V `U `T   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Y W 05  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNO!QRSTUVWXYZ[\^__ ^ ]   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~b ` PU  !"#$%&'()*+,-./`abcdefghi:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:@ABCDEFGHIJKLMNOPQRg f 0123456789  !"#$%&'()*+,-./:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~j h pu  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ q p o n   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ t r   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~>  z y x   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~~ |   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~0^1_    !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   Н՝  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~    x !@AVW`atjvukw     !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~+@ @   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ `a}~RSx@ @ @   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~6` `   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%% %%%%%$%,%4%<%%%%%%%%% #%""H"d"e"!#P%Q%R%QS%T%U%V%W%X%Y%Z%[%\%]%^%_%`%a%b%c%d%e%f%g%h%i%j%k%l%N01F45D3E89:;<=>?O@ABC62LK7HMIGJ.&$%/ !"#,+(-)'*` ` ` ` `   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~=  05  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%% %%%%%$%,%4%<%%%%%%%%% #%""H"d"e"!#P%Q%R%QTT%VWW%X%Y%Z%[%]%^%_%`%a%c%f%g%h%i%j%l%N01F45D3E89:;<=>?O@ABC62LK7HMIGJ.&$%/ !"#,+(-)'*       !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~[  PU  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ " "!`""d"e""""+""H""& RS      %xD 9 : !   0 1            !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ֿ̀ͅD  pu !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~"!" 0 `"d"e"H"& S             æ˼̾ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~œL   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./ " "!R`"S"d"e"VTW Y ZX"H""& [ \U       ^_!QO0123456789:;<=>?@ABCDEFGHIJKLMN      ݫڀެϴ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~T   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  yz " "!`"#./*d"e"+6""B;<=>9:EFC"DG"& HPQL      %MTUX9 : YVW`  aZ[de}~jknopqrs7{A|"       Ŀ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͅ\  О՞ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~" "!`""d"e""""+""H""& RS      %xD   0 1          !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~̀܄ͅާݖֿd@ @  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ " "!`""d"e""""+""H""& RS      %x01^_!   0 @ @ @ @ @ @ @ @ @  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ֿ̀ͅ ڢZ68@(#)scsi-remote.c 1.16 04/08/24 Copyright 1990,2000-2003 J. Schillingschilyremote-1.16@(#)scsitransp.c 1.91 04/06/17 Copyright 1988,1995,2000-2004 J. Schillingschily0.8    $ < Q f k r |       $ < Q f k r |    QT=G.VTP@(#)scsi-linux-ata.c 1.7 04/06/12 Copyright 2002 J. Schillingschilyscsi-linux-ata.c-1.7@(#)scsi-linux-sg.c 1.83 04/05/20 Copyright 1997 J. Schillingscsi-linux-sg.c-1.83-RH@(#)scsi-linux-pg.c 1.43 04/01/15 Copyright 1997 J. Schillingscsi-linux-pg.c-1.43@(#)scsihack.c 1.43 03/11/28 Copyright 1997,2000,2001 J. Schillingscsihack.c-1.43'6CO]jz (<Rdt 3 H h         / H c w      ) @ \       8 M f |   D |    H x     < l    @    e (}  ( T  t    $ <T t     U 4 X |   r    ( .`  I   8 ` e x$ P | |      D  p    ( `     0 \      3 T v $ 5    D t    < p    4   SmH x d      0 \ |  '   E `{ ,  P x  H ,E^v  `  (! T! x! !     ! ! " 0" X" " " " @  # \     <# `# # #    # *#  : $ @$ d$ $ P $ $ % DS_L% }p% % % % 3L% p  g~(& H&  x& & #?& Od|& '   @ h      0' P' ' '  < T j     '  ( ! 3 P x @( $h( ( (     ( ) 8)  =Wp% < \) ) ) ) 4* l* * * + H+ + + + , P, , , , 8- p- - - . T. . . . ,/ `/ / / 0 T0 0 0 1 @1 x1 1 1  2 X2 2 2 3 83 l3 3 3 4 44 d4 4 4 4 05 h5 5 5 6 H6 |6 6 6 7 H7 |7 7 7  8 X8 8 8 9 49 l9 9 9 : <: p: : d : ; (; P; |; ; ; }    ;  #   < 4< `< E < 9< < = 4= X= S|= = = ] { > m      0 $> `> > > ? p   L? x? ? ? @  0@ X@ |@ @ file_write_err]  ?bad_file_opbad_file_modebad_fileYB  tC C \wC YB {C C ~C C 0123456789abcdef0123456789ABCDEF(Infinity)(NaN)mkisofs.debugpΒ.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.gnu_debuglink 44HH !hh0' p/Q7oZZDohh`S ȓ \  e`@kĮqMwM xF x$F |W  W  (W (,W ,W W Y   }z|P`}v397Wo@"#)0 6'1<H *CK5RU$Y[ g:-M Qd/L Oc~2<<r+y.| w^4gq?7 3T WzB|q6'%q ,Z9%;66 - h ^ .B'^6W(H:?6XOxV/z W  @OX9#O- x3l<k8oXS^EFX]} JQa9 :7 -hQ'.35 zOWhHQ(+ 0T:@|& ^ 'kJ=@V3111B<{C G3&]# M%A z69@|xQE 60_Jv_RegisterClasses__gmon_start__libc.so.6putcharstrcpyrcmdioctlgetgidsysconfstdoutreaddir64strerrorfdopengeteuidmemmovegetopt_longsnprintfftello64getenv__strtol_internalusleepgetpagesizeqsortfgetsmemcpyglobperrorreadlinkdup2getuidmallocoptargiconv_openopterr__strtoul_internalfflushabort__lxstatstrrchr__ctype_tolower_loccallocisinffprintfctimestrcatsetsockoptnl_langinfooptindstdinwaitfnmatchmktimeferrorstrstrrandsignalstrncmpstrncpyunlinkfreopen64strcasecmprealloc__strdup_IO_getcstrtokforksscanfexeclpfreadsbrk__xstat64gettimeofdaygetoptsetreuidlocaltimememsetfcvtopendirseteuidgetopt_long_onlystrcmpgetpwuidgetpwnamgetservbynamesprintffclosesetlocalestderriconvisnan__lxstat64vallocfputcecvt__ctype_b_locoptoptglobfreesocketpairfwriteaccess__xstatrewind__errno_location__fxstatsetbufgcvtfopenfileno__ctype_toupper_locgetline_IO_stdin_used_exitgmtime__libc_start_mainlseek64clockstrchrfputsclosedirfcntlsetuidfseeko64fopen64GLIBC_2.2.3GLIBC_2.3GLIBC_2.1GLIBC_2.2GLIBC_2.0$si ii )ii 3ii =ii GW  . / rX X  X X X X X  X  $X  (X  ,X 0X 4X 8X X ?X @X AX BX CX DX EX FX GX HY JY KY M Y NY OY PY QY R Y S$Y U(Y V,Y W0Y X4Y Y8Y Z~AA@Ɖ) ى1)ʈW [^_]AUWS= M] }t ڃ[_]9|@1҅.t|$E$D$1҅.t1эA| uD뱋[_]US]D$=$t!9vx\uD$=$u߃[]UWVSà 0 u^ t.;\ut\1=t K\ň 0 u [^_]È 묉t$$uY贆됉|$$Y袆 [^_]UWVSL[DžpDžlE UDžhDždDž`Dž\DžXDžTDžLDžHDžDDž@Džu;ӋDPu_u'ۋDXt u9>u i €  Шu=i)|$L$D$( L$ D$n$P,D$D$$, $,$0L$$YD$/$.S@D$Z $'D$ $,8$YT$lt$$D$ $;_$YT$D< <  Шut< q uZ Z x|$$+ uዕ( |$T$ L$D$n$與D$B $,Ƅh$$DŽ)xhD$T$ E UL$D$$mut& b)L C u A:t&B"&bt&9z & t&iHZ m1C: &At&,  T::& t&   &i d `v- D$ D$ D$$£Z @T$D$o$} d |Z wOv `&6h D$ D$- D$$Ë8 u~D$ { $&[Z go3g& f df( D$`o$| a&- D$$5pZ Z - 4 h  !C  PV3Y - D$$Q5 Rv  4 -  R HNQ P@D$o$zD$o$zD$ p$nzD$Dp$Zzh ` A @! Nv t&t&- L  vF Z W-x&b .t&/t&=- 1= уD$Y$fy S  ~D$|p$xx r& p0=- 1= у_D$Y$xF - 4X +- tT T  @<  d  v<t&<t&`h \ [? @ D$p$w ] t&0t& - X5PFt&- D$ D$ D$$Z D6D$p$w D  } 0- 4 $/m- D$$1S- D$ D$ D$$:;Z Z D$ q$dvD$0q$vD$`q$uD$q$uD$q$u H Qj+ x gTBK U& V&=- 1=Z у D$Y$Yu3  t&!t&p$ DžD$- D$ D$$Z t:ux=t&fD$ Z$tMt&t& t&- lZ  Z &- xZ  , L  - H $E H  - L $&C@ =D @ D$rK=- 1=Z у SD$=Z$o: .4 Z gD$r$o - $?H  H$ @ D$-   DžD$ D$$ t 8hD$XZ$nO - p>- | -  T H $J4 t$$ع$D$Z fDŽ)/^D$ $88*$YT$mD +@ 9ЉD .- xT 4D$s${mH  l h P 4 @=- 1=Z уD$Ds$lsgvt&0Z z- D$$'`-  O- D  6D$ds$}l d - D$$& H- lZ p - P  H d ~- ln- h Z UD$s$k< H) - t - $%> d $ @ D$-  DžD$ D$$  t 8D$lZ$jy@@ f- l p ptT Z=- D$$^$# p  t$D$s$j]|h D$ D$- D$$Ë|8 u~D$s$iT -1T  Pb- D$$#H- D$$#.D$Z$.i- D$ D$ D$$ d `` $ZD$h$ @ D$-  DžD$ D$$ң t:ux =QD$Z$h8       H- $<;D$t$0h=- 1= уD$$t$gD$Dt$g- tZ m- D$ D$ D$$TZ |5,D$D$lt$og Z `Z D$t$,gD$B $B,KD$t$fh d /. @f- hU  HZ %1D$B $,=- 81=hZ D$t$)f d $ @ D$-  DžD$ D$$ң t:ux =QD$Z$e8 d ,- މt5xuCau C1uC8 8 - 9Et DžD 8 tS t4 '< t4 u Z @ t=Z ~ Z H=Z =Z 4 t @  =  1ۉ$S $FT $9P $,=Z J t( uYD$$ t @ u u uxT D$Y$ xT Zމ ۣ0 £, t D$$D$D$ $txT  $$WZøމ t,Z ~# \$ \$D$$u$i xT  $y $l $Ze 0 ZމUq£, 0 T t [މ$[P (  £$ t D$(D$D$ $uq$1D$$ua $4va$pva$va$wa$Lwa5 @ $wa$w{a$xoa$Dx^a\$Zމs [މR$[£$ ( 4$S(Zމ Yptp$W$D$S)$t4   >tD$x$_  uOuO<9u6=l u,5 u"d u | up W t| `t t A tNL u H tD$x$>_ tD >tD$x$_ tD >tD$y$^= u 5 t  l t d  tv Z t#d u<:u=p tE5Z t` u d `w>td tD$(y$] ( 1ppt5 >tD$`y$]Xt&X-uB  TTU D$- L$ $ED$ OP& D   5@ ``D$ $T$M`D$ D$y$Lc $ `D$D$ $=Z ~`1"U D$[D$ $b;]|١ D$[D$uD$ $[D$Z D$)[$bPtP $\T \\\\h  \($D$D$T$ (,$T$DD$`D$ $K E( 1p pËp$mddAAȃ$D$\$$7H$i(t&  D$D$D$ $9[ x D$ D$YD$$34t4$肼5l X- T$T$ EU D$ L$PP $3 T \1lDž!\… Ш l1tAlD$$R1эA/t Ƅ(/ȋ\t&\P\=.r/u;/t\$ $9r\s\\U\(   \D$$fu%=@0 3.tO/u 3/t<.t<t{/t&.uӃ3<.t뱀{/.t{.t&uȀ{/u‹.t; .tJ3뉍$V[T${WJ/.3<..r{/tv$yt5T , h 31ۉ$~. $`   >tD${$^U 4 u<   $x  >tD$b[$U B B  tT   dR   Шt   Шt  uD u @ t $\ KnL u H t $] -n=D >t $] n$[  n$[ m5h >t $] m=Z >~ $[ m4 >t $x] m$[ m < >t $$] m$[ m< >tl$L\ tm$ ] hm$\ \m$\ Pm$4\ Dm$\ 8m$\ ,m$\  m$|\ m $p[ l4 >t $`] l >u $X[ l4 >t $H] l$@[ l| >t $([ l $[ ~lU  ۣ >u2 {Ct$S&5<  Z L qH  [H t1Z  "- $] kZ    U tiC5@ t*9t&t$CD$ CD$@{$D$Q{ t%=Z dR $S =Z u @ 9tD$ T$D${$>Q Z ~S$D$|[+tD$ $W ЉT$D$[ D$  $We1[^_]á@ )D$ CD${D$ $W<@ D$ CD${D$ $cW$$LU .CuЋq=< u5@ u< u 4 tD${$PptD$@|$Oh u-L u$H uD uD u | tD$t|$O= D$|${O t Pɉ\{5( \T$ $%=@S 0 >t4\D$T$ AD$A$|D$O\D$ D$T$ $,- DžL- 腿 $ 4 4 #$` $@` g$(` jD$ t D$}D$}$[8| *${\$\Z u K&$Z |gZ tࡴ $!&$d\ Rgh\ >t  $ҋZ >t!$\ &g \ >t  $ҡL  XD$B  $OTX$}D$MD$~$LQ D$[D$uD$ $[D$Z D$*[$S`$[L$LN D$D$D$ $d~^ D$4D$D$ $~    D$D$D$ $[뮡 D$D$D$ $[rm D$D$D$ $[H7 Z$5T ^ " ƒ.uQu܃.u A.uAt @.oD$~$ K D$\$ZdR $\J l  D$Z$YJ\D$$# O- D$$D$~$ID$$ID$T$ID$$I\L$$ P\- D$ D$ D$$c MruCau CwuC'\$D$$8 0 `I       Z Z $'Ip$T$ I1эA=/.Ƅ(/Ƅ D$[D$ uD$$[D$Z $*[N$*$Z 0bZ f $W`$[L$LHup$4T$%HQD$\$dR $\GP\i0 \L$D$$i@.M 0 $0\G\$;\L$hGFfN@@ @yD$N\$G\D$ BD$B$|D$7G?Z >~$ D$+ D$ $M $+ D$L"D$Ԁ$FD$l\$#Fy@$Z "`Z $u?x u6=t u,5` u"8 X uT u P ti PD$$E ` aD$0$ED$l$OE  $Z I_Z [ $L\D$/ $$\9 Шt#- -  D$AYD$IY$K D$ D$ D$$\mDžDžܤDžؤDžԤ-Ԥ ؤ ܤ .ܤtǡ D$D$D$ $1DžԤD$ uYD$ D$\$JtTt $ D$膶 4$D$ܵ1эT  ؤD$\tYD$ uYD$ D$\$I1эQ 8 $ D$+~ۋܤD$GB D$ $Hr t$D$$H1M T $ D$芴Dž;D$/$tt0 >t.L$BD$ B\$$D$AD$ D$L$$_/!- D$\$D$@Z UVS1ۃuut$$D$[^]É4$u$\@ǐUS1ۋP%==@ th  t A t  At:%=tJ%=@tNЁ$ItmmQ[]á t덋 늋 낡 t̀A[]á t@AUVSu t$E$D$x $ u [^]É[^]UVSu t$E$D$赳x $ u [^]É[^]UVS 4<D$EE$D$4};PtQCU)‰UCÃ~OC,<vCD$D$ CD$`$D$<>;Pu{XuC t$$< [^]US$4<D$EE$D$荲};PtQCU)‰UCÃ~ZC,<vCD$D$ CD$`$D$=;Pu{Xu $<$D$?<$[]UWVE S]D$D$$} AD$E$D$PtxMtqCU )‰U CÃ~ZC,<vCD$D$ CD$`$D$<D$E$D$دu[^_]Ã1[^_]UVST @@@p 0t @tG6u @? @0 X C u[^]!T X9stGuD$$D<t uT 6l[^]Åu빋C D$m<D$4$;t@,D$B$V:D$p<D$4$.mC,D$B$:VUVS]u t 9C,w'Ku u[^]Ét$C$t$$MUS]t7CD$C(D$ C,D$sD$ $ACu uɃ[]É$UWVS ut F@@t6u [^_]1ҋ^C@uN t  t uzF[F QFtC <uFo$Q6bUWVSE uEE$ D$/$蚩9tb~EG$D$ѩt?u1[^_]ËEEE$読D$/$89u D$:D$D$ $ D$2D$D$ $1C$щD$L$親D$/$趨^  D$E$tuᐍt&UpU tÍE$Ъ  t1 8U  t%  Dž`11[`0 5C0~C7 5G0~G750 u2$ptH#` ~`7뚍$L$f2$Xpuhlf9Z ~H pD$ D$D$AD$D$ D$ $u81l򮍽уJ(=< хq u @ ttq!l8lBL$L$^ tlD+l$anll]$HD$;$L [^_]Ã`qƅMe {pI ɉl l҉ll @uۍx)1ًlB!эqx @ƒ.uQ`.u@B.uB@ BtB  t l!B(8lHl҉lp19 T D$ȃ $6\~!pBD$$D$.dp1I ɉllld9l.tۋltˋ @ƒ.uQt.u@B.uBt tlA!xl @eCD$ lD$ld)D$D$ИD$$v9d1l򮋂щ$t1ޢl :ǁ p;  u1ً@uѡ  t$D$D$ $1-;Xt"Xt$D$HL$ $-pp@ B lll/l @uۋlprQ(%=v 2pB(@ l<984tt$D$D$菠tC)‰tCÃ~f;Cu{EuލC$+pP %=vp%B  IpA t냋l l\#``#l D$p$D$N+Bh$kZ ~Tlh pD$ D$D$AD$D$ D$ $11h򮍽уJ(< хq u @ ttq!h8h׃)BL$<$詠h$g NhD:B(C(C)|$$dKl${gl wxZ $.hpp9 T .]y,RA l.b1 l ɉll @ƒ.u @Qt.u@B.uBtt lA!ul @u҉DqXэXKD$. $軜H9.B(C(C)L$L$CLD$$T$(pB X.$`D$`dD$$upddǀB J  A!fǁhU D$ȃ$kdǀ$ǀ(ǀ,ǀ0Z D$d$$%dXT$$&XdT ۋpxZ $@Xd $Rd\$D$$7dD$xZ D$$< u @ WdxZ D$D$ U D$ U T$D$$Y0U $4U hlǀ UWVSM }ɉ}CD$/U $iUt.EXt$Ett$C$u܅ $PD$PD$$U C{C $莙CD$/E $XH$eC(CHC,CDEC4C0utT 9EtOUB$Z 9wlUC$BSuZĜ[^_]ɋuĜ[^_]á C$ [Ĝ[^_]Ëu T$D$ E D$̕$D$$UB$fEtEP:=0 1}Ut U E PC$uXECĜ[^_]ɋu዇ $D$&$E E $`D$`D$$UB z 4$萗 E $UG!Z fLJLJ$LJ(LJ,LJ0D$G$$W!D$|$4$2< @ hU D$G$h $TD$TD$$pU HC,hU C0|$t$E $E$D$ Z D$D$ U @D$ U |$t$$Y0U 4U d-t$UB$$D$S"UWVESDž\DžXD$U $/(L$Ƌ] $bƒI 9U 8%=( tAMƒ.t,.u]C.tE%=@8%= %=( u%=@Pف 1`~rvct&S@t&Cژt^ ߘtQ@tD`t7t*ttf] D$ \$ D$L$&ļ1[^_]Å2( @ Y E1EEÈEEEE]E%=@BE%=@E(D$`D$$ԒE%=@ }1}t 1\ $` D$`D$$]Dž`C LJ{ E$茒U ${C@@LJ @M; T tA@ud]ƒ.uStV. >tHD$M $, =Z >~E D$D$ $$ U 8 BLɉX4 tJ]ƒ.uSt5.uUB.uB>tXD$M $X!]G G!EЉD$G$֔G"G# 1\uLJHLJLLJPN O!LJDE T tsM‰. .uMA.uAhHIMTTBDxHB,pB0]#\$$ M5 Uƒ.X .uUB.uBDž\D$M $'=Z Dž\8QN( Uƒ..uUB.uBzEUT$ D$EUT$$WEUT$ D$EUT$$:W8'XT.M KL$$LJ Mƒ.uQR.AD$E$ =Z  @D$]$r =Z  Mƒ.uMAu]EfK@ƒ.uUB.uBuMfI@]Ct ;T zELJ$LJ(LJ,LJ0Z D$G$$E%|$=@D$M $FLJ8LJ<LJ4E%=@8 ` Шu,t$ttEU"LJLJEEED$G$@ tHt G!Uƒ.uMQt,.u]C.jtE%=@  ƒ.uQti.Gt\8%=@  =]= aL$D$0h$^#$ЋE%=@ 5@ tM;  I 1}tOHtE8%= G!Dt >u<$ی tD5< u @ t1`(MD$T$L$ |$]\$E $`Yļ[^_]ËEU䉗($EU0,E $̖D$fM.uAi9UU.u B.uBM(D$`D$T  $蹉D$`D$T $衉yD$E $98D$T$ $AMX;AL.4 4 Uz ?.jML$ $wu܅.HUƒ.uMQ,.uUB.uB  : T { ML$ $t?uD$ |$E $D$|$] $\$ 8̀8Mƒ.s.u]C.uCD$ |$E D$U$ |$M É$L$( 8̀8C hC$4CC$" Ct CD UB9 ‹t 9u$߈O!XTtB!tyHDHTTE $̖D$2( ?IUB.BQLJD0]KBC]C.BC9A.AMQU D$$T$^MQ CC  ALJHEUT$ D$EUT$$kN(\$UT$M $yXE$D$n$ƍhD$ %=. XD$ U\$T$M $`(U\$D$T$ DD$ML$] $SAU.u B.uBfLJ$LJ(LJ,LJ0Dž`b]D$`$T \$ qM.u]KL.uMA.uA/EUT$ D$EUT$$7M@ ]  D$$\$$8^ .uB`U $HT$ |$]\$E $vs XD$|$H$9Z U9B$lT #$`D$`É|$$%MǃA $wU B $]T B MZ fǃA Z D$C$$P < u @ t/(UD$D$T$ \$ML$E $dQT D$ \$U $T$i\$M $L$EEEeGD$$  G!LJLJLJ$LJ(Dž`=.==`t& EU 0 Ή%t$ L$ D$6D$h$C|$]\$E $r  =Z Dv LJ$LJ(LJ,LJ0$VTB@HxB,pB0ED$] $=L$D$DD$E $MQD$U $M  D$JL$$KU  D$hT$$*$TvD$TD$$aډHL$D$G)D$D)$;Dg<$zLD$|$H$ D$] $d$}$PD$PD$T $蝀 T PCXT C$$ |tD$ D$$~CT $ V|tD$ D$$j~CT @,$`D$`D$É$  B T Z fH@X@$x~  P B! B fǀdD$B $辁 B ǀ$ǀ(ǀ,ǀ0Z D$B $$D$ @ D$T @$5< u @ tTT 0U mA4U D$D$ U D$ U \$uD$$YKT T ED$ED$ M D$l$L$E D$D$ $6D$D$  hU $ xD$  !Ƃ   D$$D$-L$D$EU 0 Ή%t$ L$ D$D$z$ ytD$ D$ϙ${CT $ hy.%D$ D$D$ |$U T$M $E(D$`D$$?{( (M(D$`L$${EUT$ D$EUT$$C붉L$D$ڙ$  ,^qBb$A|5UWVS<=Z uUfJ@xM É $?{Džt$Mv… ШmMZ Q$9 @tMfI@@tEfH@XUDžBLuqZ ҍX<D$~$uZ .~\$D$ $ t $Wu{ $yUBH>t$fMAH<[^_]Ë=@ D$T$ E D$$D$5 $dyD$#$t߉эqэA9e 1} ߉ʹсU $T$zр)/tfDŽ)/\$$wD$$Ktq=Z D$D$%$vn+\$ E D$$D$D$.$D$ $q Aƒ.uSu UB@#.u C.u MA@D$ \$D$U$-E $GD$;t$1w<[^_]ËE D$dD$ $ xZ $D$r.=Z LD$qT$f!f1p)D$މ4$erSrCt&D$$ D$$D$<$UE UB]UU MЈQ]UE UBBB]UE UBBB]UE UBBB]UE UBJJJJBB]UM]Q Q Q UM]QA Q  UM]Q Q Q UWVS,  E}ɉt~\ t<$Dt\ utT $&q\ D$ \ tT D$dD$$ |$D$\$qE"8 ] ]=L#ƅƅƅƅƅƅ`ƅƅ|$ D$D$$Pu~v|$ D$D$4$0u~V~l1}uƅƅ넋E|$ D$E D$$t~+E )],[^_]øՋE$lD$E D$빉\$D$$E|$ D$E D$u.d=?Y'\$$Y6USÅt C@@t u[1]Ë\ B\ C,S8uFC(  ‰K, C  t У Ct{UWVS\ED$$qEJEUD$ D$EԉT$$mnu} | D$$` \$rEԉD$ \$D$$` nx|C1D$ED$D$ D$\$$` ۉJZ @  ȅ҉Eģ@ , Mbi)U9ME$n1R@ 1P },$R] PE,$)ЃPE ]<$$fE$Em]mމ$ pEȉD$  D$$\$ $mlؙ)ZYыE i҈4Dt&6E$D$pEԉ$uB(D)t @uB(D)u~q43E \$^d X D$ -D$<$j1ɃD9DU<$ld [^_]D$X$=d U蒾R "R  @,$R D$ @($R %D$U D$$R nZ $R R D$R R R 1USEE SAX9Xt []DËC[+A]UWVSt&_ tXtuGu`?uڃ[^_]Ë$(T$ D$,0T$$}1.t@D$C $Fl?UWVSL DžDž8 D$B$(htl1yэyv|$B$D$jƄ=$tDžY ts 4$htVu닕B ɉ!t$cL [^_]Ë$(T$ D$,0T$$/=Z dG4$D$GD$C$4 =C!3G XX9}ʉXǃX D$ D$@D$D$ $cDžD$$} ƒ.uQ.u A.uAC!x9_tA?ut$թ D$$D$:9_uG,4$D$G,1ҋG(%$D '-G(%D$C$Zƒ.uQ.u A.uA; #A@,4$D$PB,B(1%$u,QB,B(%D$C$7A,4$D$|B,B(1%$+A,A(뇋 $(ȰX@8 1LPA T Q$ T $5 (^BxZ BD$D$ @D$ $D$WA  QAD$4$& $* 1% =8   tB =Z L$D$ D$ΛD$ $ 4$D$Tx@$D$e $cBP T 5@(D  D$$Vx`Z z1 D$ AD$؛D$ $gD$ D$$D$qD$$eUWVS w > ubut  tHtD$jct]64t$Pc ǃ4t$4cǃ t$cǃuGG u?D [^_]$?$baUWVSG)Eǃ}?CuEuG$JEЋE%E=vEe]]؁ D$G$G $\$}GUMUL$D$$g^EEE]G)Eǃ}S<4UH 8UD$L$$^8UEtMEM64$j_ǃ4$nMEL$D$$Y_E @  EyAyy oPyUaUSÅtC@@u S8` Cu u[]t&UVSE EAS@89B8r!wA)E C)E[^]hY[^]UWVS  $~$ q\$  D$$]^ \$D$$D^\  $%\ ` D$T$$^ \  ` D$ >D$D$A$L[\ 19}% ` Ë9r8tr8؃9|u ` 9/{GG(  E𡨠 M   M  S,T$   $/C,D$  $4CP8 @8D$   $C@81ۉD$  $ 0L;)    L;)    ;]|ˡ t ;5\ }m ` t$D$${D$$T$D$$C `  $[  ` 9tD$ T$D$0$(1[^_]U1WVS] UuэA9~ЉE] u[^_]YUS$VD$D$ËE$v] Cu] U []É] []UWVS<}D$D$$Z  tO1ۡh 9}>D$D$|$ D$D$ $h 9|@    )ȃ=Z ~' D$D$d $5P FD$D$|$ D$F %D$F$^N ۉډ5 1% @ @ F L F$xYF u 8 tLF1ۃv~#€; Шu8u€; ШtΉud=0 uEEu1[^_]t<;<; Шt<; ШtUB뾉tʼn|$t$$@TYt$Ld|$$eOt$$eʀ;`E6E${D$UVS1ۃuF)d  9rtӋu[^]Å.tt$5[1^]Ë UV1S  $4؅u ~ԃ[^]ÐUWVS ]t4t-UT$U $T$XZ D$  $ D$  $   ң  u  [^_])E|$D$ BD$D$$ D$ء$D$ D$ D$葽D$$}D$$谽 ۋ )ٍAD$ $ UWVS  < ]  U1  @ƒ..u C.uC}1W)EуH(UB(!B  UE]+ED@;E EMMƀ Pƀ Xƀ $ƀ A  D$$ٺ ]S  T$$赺 S  T$$蔺 S  T$$s}O ȃ% = =` Ш+  C0;  ]MƁ PƁ NƁ Ɓ S$C   $% É\$边}G W$  0   $L$艹 O    = UM]}EU+ED6;E]}MԀƃ Tƃ Fƃ ƃ ƃ   GH$D$1 W@  T$$1 WP  T$$1 E tH+   ;  M@ƀ Rƀ Eƀ ƀ  Etl E+  (; MD$Ɓ PƁ LƁ  Ɓ   $߷ M Etm ؉]+  (; *ED$ƀ Cƀ Lƀ  ƀ   $l M  tUB%=sER ]ԋ}ȅ҈ >t )ЉD$ $ $w E4< uЋU8 D$ D$ $+ Č[^_]SMA(UB(!B3 B= E  FMA%=5@ .2E    E)Ћ= D!UM9}EEƀ Rƀ Rƀ ƀ Eƀ E ƒ.uSk.u C., 1]эq UE+ED";EN>E}C Ƈ N9Ƈ M Ƈ = M tUHtT,  T$ 0 T$Uĉ$] )1}<b   = UM]}UEU+UD!;E~EE)E]!\$D$$$脵 MUB$ D$| MQ  T$$X} 1ɋW @t tt@tt@ L$$ ƀ Xƀ Aƀ ƀ ƀ ƀ ƀ ƀ  F <  ƀ Sƀ Pƀ ƀ ƀ ƀ P Ƃ    _}HN E+  *; 0 M}Ɓ AƁ AƁ Ɓ ʋH@H  H @I H @J H @K H @M H @N H @O H@P  Hf@9 H@8 ȃ  MKt   = EUM}== }3ͼ MƂ ̀F(m Uap= }+ED$D$ $ Eƀ 1 ED$у$M|Z ME q 1E >uDEU ~ D$ D$L$Ե =   M؉]})T0 9‰E"E.E}+ED0;E5MUEƂ SƂ L]Ƃ UƁ Ɓ  ;}D$/<$EtmU<.& +  ; BƂ Ƃ  Eut}E}xo]UMۈ  =   ]Ɓ }EUE+E}D0;E + EZ    Ћ= U)ȉM]D"}91}щ΃>u+.E    EUM~}UE+U;D;E~E)}E)EUM\ }9U T$ \$  )މ$! MU؍L ])]ң M8}.K]/Et;=T t ,[^_]Ë ?u,[^_]ÍD$D$$@ ƒ@ \D$D$FD$ D$+  FNNNȉD$F N N N +  $D$D$\$ D$D$$vt  uF!. vuG@UWVS1ہ,}D$D$4$ƅ<] V@FD$D$|$ D$D$4$S~@ ,1[^_]UWVS\] u   D$$ D$<$ @ Z $ @  "$&(,p$ $D$  D$D$褣ڍ0$Yuj] ` l$D$zD$D$t$ D$D$<$跖D$D$<$ @ C@ Dž*UDFDž LV DžInfoƅ ƅƅZ \$RH$D$D$D$t$ D$D$<$ݕD$D$<$ @ C@ ƅDž+NSRfDž02ƅn  ] +  F$D$D$D$t$ D$D$<$D$D$<$ @ C@ <Z $tdT $0ƅƅ$D$D$D$t$ D$D$<$ȓD$D$<$ @ C@ $D$D$D$t$ D$D$<$OD$D$<$O @ B @ D$D$t$ D$D$<$D$D$<$D$D$t$ D$D$<$譒@ yȁ\1[^_]UVS $D$D$5@ ] F@ LD  I@ D. L+  Pfp t xz|غ 4$D$@ B@ E$D$ D$D$D$D$5 1[^]US$$D$D$@ B@ E$D$ D$D$D$D$轐$1[]UVS $D$D$@ ] ƃ@ +5  cN>;+(fhZ $'C(Z $  @\+   غ4$D$#@ ƒ+  @ E$D$ D$D$D$D$= 1[^]UU 1UU 1UWVSÁ,D$D$<$9@ s=D$D$t$ D$D$<$衎@ @ 9rÁ,1[^_]U  U]lU U]VUWVS,@ L }XuD$D$4$)@ 9sEB@ !D$D$|$ D$D$4$̍@ 9r,1[^_]UWVS ]MUVS]D$$$>D$ yEY[^]UWVS U ]E2 {X{1tQǃtJG !$DeG !$DڸL4$@ڸL4$ E tG!D$Ĥ$D$褊D$$萊D$<$Ê~*C<t"<tڸT4$ڸT4$. [^_]À{A{ 28 uD$`$8 D$g$ UWVSÁLDžDžDžDžSB<uuuupumu u@u u u u3C$,C $C$ C)Ã1uL[^_]ÍD$t$$u$ CD$D$`$D$ ‰D$蘇L[1^_]UV1S1ۃU B !T!)u ~zXt,UMtUE$\ É[^]ÀzAu΀z uȃUWVSÁ\ DžEDžDžD$$D$fÃC,<މ9މu3C$)C $C$C)CÃ1uhRU t 1\ [^_]ÉЍ)$D$jD$;$t$M 벍D$t$$s}<$\.pCCD$CD$$CƄU th1򮍽ʹ҃4$щL$l} T$$[l<$U ǂ@CD$D$ CD$`$D$d\ [^_]UWx VS\U<$$CEF$ۉ $T$UT$ r<$EM9EԉEEUM9M}}UtEEދE$CE}؉EE9}ĉEEE&EEE܀8EeM9M|EEԋ}9E}}jUЋ2F(EF!tD1;}>|:MЋ1EȍV)M̋L$T$C)$u C!;}|ƃEEE9E|E1}}ąu5< ]t }<$EUԉEȃ\[^_]$`AUЉM܋L$D$$E܃}ЋE$U܃ U$ǃfǃǀ(ǀ,$ǀ0ǀ4ǀ8ǀ<ǀ ǀDE0ǃ ǃ@ǃǃǃdžHUM܋]܃!!UQ )E̍<}u m}= EeƆUЋ@(ϋM܀y w p t}ЋD$E܉$BMЋ4$U}Ћ7~(+xZ 1׹T$$уL$u^EЋ0 xZ $} <$EE$EEuEEUEM̅.Ẻ8<$\?UЋM̉4}싀4L$|$$EM܋EQ 0ҸD$t))ЉuD$4$~) ~)$tD$D$h$ r]$u>ۉE UMD$T$ $lE}}}*E+E;E}'U< ttEE+E;E} M< uE+E;E}}EUԋE9UEEEԃE9EMЋ1F(]ÉẺ+E;E}ʋUF)}̃|$D$$6uE|8 uCD$ $Åtx}Ћ7@u# >t $ 7$ UЉUU+E;EM $$MЋ1 $UЋ2?$7D}Ћ  NEE  5\$D$$.}< D$5D$D$ $ D$2D$D$ $ D$-D$D$ $$k< $.;D$D$gK$EЋ01߹у $;U쉆\$ MD$D$$複USà u,u44u<uD$[]É$t̉$4tĉ$t$$[]UWVS ~ttMu<$v [1^_]UWVS|Dž] ~%Uu9|1|[^_]Ë t.uBtʋ  t} $D$uE@!Dž4u11 uIEu.MB A B A}4EE}|[^_].u B.uB8DžDžDžDžDžD$D$$Ã>u nE<DžD$\$$fC,<u4C$MQ%9tDžDžu%Cu3C$|C $kC$ZC)CÃ1UM؍<3BHu؉ $D$󦋵!;u}؋FP<$u؉D${ !C $ E<CD$D$ CD$`$D$qvUS]D$$, t 1҃[]É$oeyU]fUVSutl @   ( ( D$,$t'( D$ D$ D$$~CD$ D$ D$$Y@   ,1[^]á( hD$T$luOD$$SuUUWVS1ہ,$cYD$$T$b=tE$D$uuu1dtW=urxu:$3D$Í$D$؁,[^_]ÉD$D$$s,[1^_]ÉD$D$UWVSLDž4Dž8DžD$D$ $B,<pJ$ $$sB)Bƒ1u;L[^_]ÿMuH둋D$\$ $-`DžDžDžj$ V1Ë${0 KC0 BD$D$ BD$`$D$wq0$ 0H4 P4 UWVSL DžEDž9Dž>| M94t׋ t< =xZ $|$F $BM9ztdw =xZ  .uJ ; u։|$ $Ft úL [^_]F! ƒ.t.u A.F F$4A A Q<.u B.uB.t&=xZ |$ $ 9u0G L [^_]ËG4$D$1fDŽ)/ 4$D$4$[4EAI$Pj-D$PD$$QA$BB$ArB B(B,JQB $D$1򮍽fDŽ)/ <$D$<$oB<$^GFDž1;.U!;.&Q! ut[A A .uBu fH@ .u B.uBu fJ@ȍHA<$D$1fDŽ)/  $D$l$A A ‹u: D$D$D$ $SD$C $jPUWVS DžME tU:/uEuUtU:/uEu$}E8$ ]t2D$ D$D$U$BEUZEX +}( |$$Y)t$$)T$t$|$ \$$D$$nut ƒ.uQp.u A.uAVD$ \$D$U$AUT$ D$$T$ $0DžE2u$L [^_]ËUD$$T$gXEtD$P$g 1[^_]Ë D$D$($9t  (t [^_]ËED$$D$fË$$EGUWVS4 t&50 =T t 9tIu[u[^_]ËSAAStҋG >u ȋ.tS9uCUWVS 54 >u Bvt"~vtT  @XtLvuދ54  ^4$ޅu50  ^4$ޅu [^_]9{uD$$el^C D$m<D$4$'t@,D$B$cD$p<D$4$z'.C,D$B$cQ8USE M]9t:Pt*It#BDBt:t/ @ t Ã[]$d@ ߃_[]UWVSu_ы]܋MDWMAPUD؃E]܃;E =E t M] DUE؃<[^_]ËEx뗃?.t\ut&끋XM]M]1}E $щED$YD$ D$]D$] B] C4SUE|$T$ D$$jUt$ÍET$ D$$J ‰to1.01EfMfU E f9.M>.,1[^_]ËCHTϡ( FҸ륋C9ы@ H;T @Ã.uMA.*8 }}t&;};u ;EMD$ U $D$T$=ƋED$ UD$<$T$uE 11uYEfMfW E f9r8qU҈UBM%};!;!,[^_]Ë U0 U1HTE ( Z MD$ML$E${D$ D$ $D$#VL MAB u8.# u8A}E8.,1[^_]ùU1WVS,U҉UkM; T t 1A@6}_ =1 / uC! Eƒ.uMQ.u}G.uG tHtTM0 D$ ${   EMƒ.uQx.u}G.uG[ tHtT0 D$ $" U1B@B 1BU u1$8MÅt uu~L D$ ED$t$$t1ɃDB9D}@$E5L Xt [uuMQuc}?},[^_]ƃ "U; T}> P tV  $$!t럋  U( D$HU( D$H } W0%=v  [UB0UWVSL+BtB@;T @@u 9B4vB01%$D$T$$@B  u٨ t6T p 9i6uD$$CK,0< w<u< :}؅;uMuVUȅu. u%Z ;EmmE.ẼEU  uE;1ẼEUE UfEEEE܃L[^_]D$.4$诵E.EU;Z 9uąt+}#B< w ËẼE  .EȅE9EEȅE9EEɉ u ߶Dxt ̴֡ 9EED$/$%sUXt$C$u]uE$`,D$`D$$U54 B BLZ XC!fǃhU D$C$Z ǃ$ǃ(ǃ,ǃ0D$C$$8C$D$8Eǃǃ<$ D$\$<$ < ' ɉ u @ t@t\ t ' @Uǃ,[^_]á ߉ED$' $XD$D$ U D$ U \$|$$Y0U $4U {_t$D$$&9% D$0D$U$DE$D$D$U$E艃,[^_]É\$D$$8HUWS t[_]$ ǣ  u   [_]Ë   [_]U ]UWVS  D$D$$ 1Z f 1D$   CD00  EL T ORIT O SP ECIF ICAT ION$UEt uZ D$Ԯ$D$P7E $E6$ D$|5 1   PtG1ljىуwًPэQPT$$ D$XP U D$$ 141  Ã~$ \$q4M  B B B  B B B BE 5 \5 ~}V1ۃ\ÅEMEȉ ẺD EЉD EԉD E؉D E܉D ED ED   M\ uED$D$D$ D$D$$ y4@ 1[^_]Ë\BD$ $pع}󫋕\B<$EȋBD$Eȃ$2\yu;pۉȉfƉ 1% tZ ~ |$D$$T;\F:Z E~% D$D$D$ $D$p$ǧkD$D$% $=tp$(D$3$٣' f'  fUt$pD$T$D$B3EDžXXa' f`'  e' fd'  b' ҄h}CE̋\@u4X^' t% D$&D$D$ $萨ڍ% uX_' ƒ Шt% D$,D$D$ $:hhXh? ЍPc' h9t T$D$$ 9X}KEȉ|$$0p $0D$Eȃ$$0\AD$p$^dEDž`DžTD$dD$ $}~q``?Q1 $/T~ዅd`D$D$ $ p1ۋ`11 >t$pD$$D$0dD$ D$D$$WU1׹󫡰 $D$.pD$E$.pD$E$u.ET$t$`.dD$8\$<$͟<$  D$)؉$D$pD$DD$$/D$h$/= \@D$$ +`D$虤pD$$D$//\H tsZ E. D$ D$D$ $薤pD$İ$D$.Xb' @ tz` Z E.d D$D$D$ $+:D$G$-.Z E. D$D$D$ $a뜋pD$D$&Z E. D$D$D$ $}Hp$$D$-t\AD$P$D$^-E$|D$e-UED$$' D$臢?( UED$$+ D$]+ UVSp@( A( ]B( C( L( M( |( `}(  ~( ( d) e) ^f) g) h) i) n) o) p) q) r) s) t) u) v) w) ) ) *- $D$,藛tt~D$ѱ$+1N( O( P( Q( - .uC.u C.uCE$D$D$$脜EċUD$D$ $T$zKȈ ) ) ) ) N( O( P( Q( p[^]É\$$*JUW1VS|) `)  ]) ) ) ) ) ) ) ) ) ) + + + + + + + + + + + + + + + + + + + + + + + + + + + + ^+ + + + + + *- $D$,轘tt~D$ѱ$(1 * *  *  * * * * * !*  * #* "* 1- ;GE$D$D$$茙EUD$D$ $T$HȈ* * * * ~Ɔ * Ɔ* Ɔ * Ɔ *  |[^_]É\$$'I|$D$$t'U1ɉWV1S ‰ÉܸŸUЈ) ) ) ) E - t&.uB.u B.uB͂) ̓)  ́)  ̀)  tgfff|) }) ~) ) )օ.E]BU4E+E܃[^_]ÍAʃ)v) w)  {)  u)  t)  z)  y)  x)  .jډωUUUUU|) U}) U) ~) ŀ) Ł) U؈ Ń) ł) N( O( P( Q( ~UE+E܃[^_]úUWV1S1ۃE ‰ÉŸUЈ* * * * E .t* *  *  *  tU Aˆ * *  * * gfff)Uƒ Ш]} ZM* * * * A'* &* ljƉ*  * * * Q * * * * %* $* E+* ** Ѓ)* M~- - Ј (* - - - - - - -  - - UU- xE+E[^_]ËE+E[^_]UWVS<D$D$$蛗 @ ̍)ȅ~CËED$D$D$ D$D$$*!@ uH v<Fw bu - tt.uA.u A.&b* *  *  *  ‰vD$ $iSÍD$D$$3D$D$$ED$D$D$ D$D$$@ u $肐H  @ +  ۉL$ u D$ D$<$ '<[1^_]) )  )  ) AV- $ZD$- $YD${U ; tD$d$  1UWVS,D$D$$腔 `H =+ + ,) + + 0+ 0+ ȃfލD$BD$~- $QD$D$) $3E$D$ D$D$D$D$@ ,1[^_]À=' ' tQ' ) ) 0) 0) fuD$D$' $Y fIJ D$$xxEt\E+EЉE؋U؉T$MЉL$$u*>у9MMhEEuE1}ESM- 1jMARE- 1}EЋ}хL - tMU EPA@ 1r- ;- t- <[^_]Ë- 9- - 9tE - ;]U 8-C;E- }pM Ë:-uzu_܋]- ]- BH- - c- 9.v- kÉ- BY1Ʌt<-D - p- UЋuЋEЃ5- |$U$识UR- €:-  Шy:t <[^_]Ày:tsUЀz[5- - - ʡ- EcU܉uUD$E$. - M,EЀxu- 뒋My;U$CM - UB 2xuvt)M x-tUD$M $u ^ tDE z-r- D$D$ M D$lD$ $c- - YC- ?- ;UBM - - E܉uEE=^ ?= ^ ,^ )}ЋU1эL - M9:D:^ 1}ЋUэL - )^ )= ^ U<:|:|$ M D$4D$ $04^ tKM Dx-MD$M DD$ D$D$ $- E1}ЋU?эL - M DD$ D$D$ $- EM D$ D$ND$ $Y- - E|$ M D$D$ $$- D$ U D$ D$ $UD$ D$,D$ $ - MUED$D$D$E D$ D$E$ÐUED$D$ED$ ED$E D$E$PUED$D$ED$ ED$E D$E$ÐUWVS, ]}  - u @EЙ}؅]>e - - 9~Ӊؙ}D$ ËE|$ $D$3x- $襣t $YE])DžE[ ^_]É$aD$ Ƹ4$D$T$ !Ѓt0]|$4$ \$C9t $YD[^_]$r.USt]TED$ $D$D$@D$D$ D$P\$E$o- D$$ߠ- D$- $- x]%D$- - $z- D$<$4t[- @$$- h$t[]뜀}uYD$\$$t[]á- h$$- $U, u- $É$EÐUS]$议t{$~1[]É$$uۉ$%t$t $ uUS]$Dt$71҃t[]É$菮!t1$肮 t 1[]É$襮 u[]É$苮t$uUVSu^@D$D$l$CF$CTC CCCUV$ЈCUFDɴu[^]4UWVS ]C$$lS$BxC$ [^_]ÉS$1$4;} }\$%yNC@@(uՉ$GE$ͬtuC$~BC$1뗃}:ƒ}0 Шt؃k$ [^_]É$M$ܧC$UVSu^@4$x [^]0҃{ 4$4tI4$t$ |4$Ey4$t&4$뙉4$y뤉4$:UVSu^@D$D$l$ CTCCC CCUV$ЈCUFDٴu[^]:UWV}S$йEh[]tK==='=t&A=t&>$ݹy=[ &de&>$)=;='t&-c=0=:t&>us$$ ===t&>u3$&A  D$$9Eh[]I=Xe=Dv=Et&u$R == =u$e$u$==J$=3$=&$=$Ǻq=Y=$غO$C$7$+$$"$3$B{$U$]$q$$$$$ǻ$׻${$o$c$ W$K$+?$:3$K'$]$lUVS]C$s@$k$1҅x [^]Ã~ F+$9 D$r4$>9( E@<UD${$>M9$<>UDžDžDžDžDžDžB<D$$D$D$D$ D$D$_t MA<t E@<t UB<t MA<t E@<Eu h$|U0 J< $D$$ ;)MAu MA<:ED$a$t2U9MA<;MA< EMA<UVSu] \$4$31҅t u[^]É4$US$EE] EttD$ED$D$ED$ D$ED$$1҅ttE E$[]UVSӃމT$D$$pJغ颋.$)T$)^$ )\$ [^]UWVS,}$<t ,[^_]ÍD$D$$ӾD$<$vG$Ɖ\$<$vo$t$É<$R.t$ xC< <?$"X$':/D$2YCuBD$$G$D$TYCuBD$$GD$eYCuBD$$GD$vYCuBD$$GD$YCuBD$$GD$YCuBD$$G\D$YCuBD$$G4D$YC uBD$$G D$YC uBD$$GD$YCuBD$$G$ .-D$CYuBD$$GD$YC uBD$$G`D$.YCuBD$$G8Ct(D$YCuBD$$G D$Y{xBD$$GD$HYC@uBD$$GD$YCuBD$$GD$_Y{xBD$$GjD$pYCuBD$$GBCt(D$YCuBD$$GD$TYC uBD$$GD$|YC@uBD$$GD$YC uBD$$GD$YCuBD$$GtD$YCuBD$$GL$ *D$CYuBD$$GC$ *CD$$@^ D$ٿD$CYuBD$$G豿D$YCuBD$$G艿D$YCuBD$$GaD$8YCuBD$$ 9D$YCuBD$$GD$\YCuBD$$GD$YCuBD$$G$ 3)CfS ¸60CfS ¸JCfS ¸^{AfSC ¸r{C S D$$ЉD$C<<CfS1$s ҉T$н;.|$$賽FfV$u ډ\$菽F$$`^ D$lغ.$T$P^$ T$6;g?$fSCC S D$$ЉD$D$CYuBD$$G込D$0YCuBD$$G薼D$dYCuBD$$GnD$YCuBD$$GFC .D$YCuBD$$GD$YCuBD$$GD$YCuBD$$GĻCD$$ ^ D$蛻CD$$`^ D$m3$ CSD$$ЉD$7C*UE]BUW}VgfffS)ˍ )ω)ʍ 4 [)^ ω_]UU)E )EMY… Шt ]Áf]UWVS}j|rk)t؉ )il]𻵁NEE))؍] C1r- S[^_]Í^=ǯwWfk)t؉ )ilf]𻵁NEE))؍f|U 1BB[^_]Uk)tWMVu SN )iǔ))V))N[^_]UVS0]u xB~7E4$D$ED$Et$D$ E$TD$0[^]ÍE$D$FED$E\$D$ E$D$袸념UWVSLDžU$}t E$GDžDžt DžD$D$$It DžG$<$荤D$U T$ T$<$D$+1t G<$D$U T$ T$<$D$G(o$uMSօuz~ ] \<$B)$<T$D$jLG(SօtFt$$D$0L~k] uFD;$?;E U T$UD$D$8T$ $觯G$tUL1[^_]Ão$1ȋED$x$D$TO9ED$$D$0뎃o$끋UD$$T$ t ~AE$t U$EtfD$D$E$tG$<$̡o$D$U T$ D$E<$D$iG(zEtfD$D$U$G$<$_o$D$E D$ D$U<$T$w(]tfD$D$E$蚮G$<$o$D$U T$ D$E<$D$菽[O(U tbD$D$U $-G$<$腠o$D$E D$ D$U <$T$"lG(ucL[^_]ÉED$$D$$<$,?)‰T$E$<D$HZ<$?)‰T$U $<T$Hq<$>)‰T$E$<D$H<$>)‰T$U$<T$iHCUD$$T$$DžED$$D$DžUD$$T$ЫDžXED$ $D$覫DžqUWVSu]}~UFt#FFFxЈV F F C$$jC$tFC$@|$ $<D$Et$$D$x [^_]ËC$C$$ k$@D$ $<D$Et$$D$袽yK$t 1[^_]ËE D$\$D$聪ED$t$$&F1UWVSà U@H @M 1уw1׹эAD$CHT$$1҉уwйэAD$CMt$$|CLCQ [^_]USËEt t:t u[]%UBЉ< v B<w Bȉ]ÍB1<wBUW1S1уv&z8DQt DAu1[_]~r$[_]UWVSӃ ut2t+ƒ%t:u)_t?u [^_]á$ D$0 D$‰$Cơ$ $%D$0 D$UVSÍ@$S}X ufF8[^]fF8$/}fFBC$ }fFDC$}fFFC$}fFHC $|fF:C $|fF VSDžlDžhE]Hp1fxlD$U$t1D$ D$D$$`> 1tzt<$p=Z 0EU D$ D$ET$$ÁĬ[^_]Í[U^ D$ D$8D$ $"뛃tA$`> y=j$d> y=t$d> x=@$x> x|$ D$ $z> t$ADžtz> Džd>  %t d t$fxu͋t$PxD$ D$<$T$d$)xx|$ D$D$$uƅxd$wh\1Džl$<$l'p/xh <<y~ $pt$UwD$ D$<$T$#d$.w|$ D$D$$}Džlnx$qU p$`UWVSTDžhD$$t1t ` ȺB)Rp))lt}D$\L$ D$<$=}uFhp9hulDžhD$ D$T$t$$H`TPDdTU }$UxET1ҋEAEAEA EAEAEAEĉAM؉`< t~鸒ut+.1҃`< t`~x<$ dB@t$Tļ[^_]UWVSLD$$1>ut$H^UX pDƉ$FFF FFF^@F|$ D$,D$$g<$L[^_]UVSu$tvDC@C 8t$ك[^]UVSÃC@4$D$:t[Du1[^]Ã[^]UWVS uUHXHtVEu$U + 1[^_]É؋U x.tԍ@ <$D$y؉E [^_]1*.tXHUWVS }UHXHtzEu$U 1[^_]1} @. у $U غ@. .t@ 4$D$؉E [^_]1|.{XHfUWVS x$T^\D$TD$$I XD@> H9}Y 9}H^ uꁸ^ ,tދU\$ |$D$Y$^ 9t@> 9|[^_]U1WVS,E}} щMы@> )M9}vEEEE9}O<^ u⋇^ 8t׋E$@. D$K^ tL]@> EE9|MUIL$ T$U $@. T$^ ,[^_]èuhU uZT$ UD$\^ D$E@. $tJD$$@.  aE苌^ mY럋^ $@. D$s뱋M$@. @. L$Y1уǁ@. /.ApǁD. pleDǁH. oublǁL. e/.PǁP. arenfǁT. tOU1WVS}} щMEыT)M@> 9EEEE9>^ uދ^ 8tӋE$@. D$h^ @U tYT$ UD$\:^ D$E@. $ZD$$@.  uM9T @> EE9OEU MD$ D$T$ $^ [^_]ËU$@. T$v^ E D$ vD$\0^ D$E@. $芤MU vL$t$ T$$@. 0^ M9TO[^ $@. D$ Yt^ $@. D$ 뉋E L$|$ D$$@. U:^ MTU1WVS,E}} щM@> )M9EEEEEEEE9a>^ u֋EUD$$ ^ 8^ 8^ E U܉D$ D$\:^ D$EE$MD$ $E^ e^ D$ E D$ED$\E$莢]^ uMD$ $'>uE^ bExwM E|$ D$L$$U:^ $. u-@> EEEE91,[^_]É$( $. 뿋ED$$ E.xNjUD$D$`> $6 . ~yED$$U$. $ $. nYZMD$ $ nU ^ T$ $. $k ,M $UWVS]Eƒ.uS1Ʌ.1Ʌ=`N } 8 8 8f 8H8* 8 Et|8 8 88EEt@ 8X8:E u E@ 8 8)8 18 <8 8r1W8T I86Et@ T8  8Et@ <8`8EtrD$:$Et[WNju8tcp u8tFJ u8t)Eti8t1Ƀ[^_]C. C z8t€}%8t#US]D$D$ $ۗTRD$^ D$ $诗HD$ D$$萗C)D$ D$$tHMD$D$ $RHHD$D$ $0[]UWVSUWVSLuE]H$+ ~ th=Z -E D$ t$D$E$ÁL[^_]Í[^ D$ D$8D$ $ő례uuEU $Eըu5tEۉ$_$[bG0j$~붍E׉$V_$*bG,EUSUt7ǂD $P$B][]5[]U,. u%0. up uz$$UEtD$$GB ՉEƉUWVSLDž]E f@> 11^ |u ^ |p `N <. >tC$>t6$+(p `N @> <. .u4. 8. $G0. @ @ 0. @ @hZ 0.  pt! t +hZ ~0. dZ x  t! t +dZ ~0. @fPE8u,. L[^_]ËUD$B $}$GDž,. D$T$$@. D$@. D$$}.t=@. #.t98. $zFD$@. Ípx @ t$|$ D$(C D$dD$$C D$ CD$CD$CD$$ U D$T$$蠍$T$D$$8. ;D$,. $,. _$ N$@. CGF1fCK*t2t6<. 9~У<. ,. 8. 8. Buʡ0. $0. ЉD$,. $,. /$ $ ${rUWV1S|E]}UD҉UMHM$x> YE$d> Y;uEE(. $MEUE $UEU|[^_]ÍG$SY}`> $8Y$H\UB,C$Y$/\MA0EE 9E}T<$X wt&$D=Z %D$ ED$U T$E$ƒ|[^_]á(. G $XE`> EE9E|ҍw4$uXÍG $eX\$`> D$E$4$EXEƋE9E1냍G$&XMMA@G$XUL PD$Ѓ$uEE9EG$WMMADG$WU< <U~ $= .  |1[^_]$`> QW=u$d> >W=t$d> +W=u$x> W1ҘE@C; . A$CA\$(. D$z> $Uh$U EUNUR^ D$ MD$8D$ $u$sV$GYUB,C$ZV$.Y6$JUWVS usDH> $> p> f>  ¡X fS8$> U$XC,$> U$XC0a> <wЉ$غb> v$> {UC@$> lUCDC@dždžLdžPD$F$~CDLJC@LJP耉LD$G$~E [^_]fS8$> TfC:$> TfC<= . ~p=> ug=> u^a>  uJtF=b> t=1҃b> t*91Ҁ> t> t~S 1[^_]$lUWVSEH$E?y=Z ,D$ ED$U T$E$[^_]ËUR^ D$ UD$8D$ $l뜉4$mS=ht$>Sf=\{$/SG,/_tF($SG,tF4$RG0UD$U ~TGDǃLǃPD$C$!|E[^_]|=wǃǃGD$TUW`> VSDžPDžLE]H\1fxP󫍽hUD҉XMD$ $t"D$ D$D$$`> $d> ~QHtIt<$>=Z ME UD$ L$D$$Áļ[^_]Ãt7$`> Q=uHH Ш{$x> P|$ D$ $z> `D$FuDžPDž``DžTDždz> 9Ld$sP $l[U^ D$ D$8D$ $%H+H>u>h$P$S\B,l$O$R\A0T`d 9T/<$P3\xpL Q<I<y~ $\` $ zvg1Ht DžHd$ND$ D$<$T$d4$Nh|$ D$T$ $)oDžPd$zND$ D$<$L$Dd4$LN|$ D$xD$$uƅx4$NL@d$MX\BDd$MXLPD$ȃ$D$D$&D$D$D$6D$\T$T$d$c\B$D$d$2tZ ~)D$  \D$H$T$`uL UWVSLpN =Z E\ D$D$Eȉ$ + E4?=`R N 40%;Eĉt}$E 1҉]+ =`R DƸtCG,ÉW4y 40;Eĉu+w_(EȉwD$D$<$'Jt.`R PPT$E $D$- E$轤`R D$D$$E]UpN {xS pZ x?4$Gx.`Z 4$D$ + D$[xڃL[^_]áZ 7`Z $D$D$_[.xɃ=Z E D$D$D$ $Z@)$I`R @8too @many@ fil@ es f@or H@FS v@olumf@eL[^_]á 4$+ D$<ED$tD$`R @8$v뱍ED$D$UWVES|D$TD$$lEEDMGREEBTFLE$fE@EE`R p X D$|$$ UՍED$T$ D$U$?doCD$$?C $D$?C D$$?C"$D$%t?C$t$$x?FD$C($f?C.$|$W?C2D$$1?Cx$D$ ?CzD$$ ?$D$>D$$>$D$x>}D$E$V|$$qU$T$_`R U D$E $D$fW>y.da $fUD$T$E$^.xҍUՍEEDTFLEET$ D$D$U$vbED$D$U$^x |1[^_]áda $|[1^_]áda $(da $UWVSE=Z }EƀUƀ@ ¡D ;E@EM4 MD$XE+@ ML$|T D$  $nƆƆƆƆƆAƆƆƆUD U@ ;E~VE)Ћ|T D$ $,e@ $f<C$e}AeUE0Eƀƀƀƀƀƀ9~σ[^_]á D$D$D$ $4'UƂƂƂƂƂƂƂƂƂƂƂƂ + Ƃ E@ @ D$D D$ $lZ@ D$<)EU|T D$ $hl$>UWVSDžLDžH] `R SA$҉TU B R(,HU‰@<BBKAߋ,)ljB ,((1 % @؋PDu1[^_]ËuFT$ UuY T$D$d$fT$$D$ D$uF$D$ D$D$$/=SPu Mtу urD$4$|$[-$, P$B$,Of$HO$$H $|$$dO$$   ‰D$ D$D$4$у D$|$4$:$,    ‰D$ D$D$4$у D$|$4$   ‰SD$ D$D$4$4 4$H   ‰SD$ D$>D$4$у> D$4$D$f ffSD$ D$D$4$94 jD$|$4$Y   ‰S D$ D$D$4$輿4 D$|$4$   ‰S$ .>C JDžD$ 4$D$T$31 $HK#D$|$4$   ‰SD$ D$D$4$c4 D$|$4$(   ‰S LD$4$T$!t $,f ff$ B.Džf9.kDžCDž DD$ 4$D$T$#31 .D$|$4$8.GW G   ‹A9ȉ,UWVSӃ u} $þ$軾4$賾} [^_]餾US]C$菾][]邾UWVhS !]D$$\$詾ƅh$t\D$\$SXhxuL$ D$D$$St$\$$蹻X@dA8$4\$D$$谽$dv0434$,4$x($f+d$X$Kd$H~>t:XAHD`40DT9`|19}Z19}M49}604049|9|119}C4D9 0,4(9|D$D$\$PD$D$\$Pɉ# X<$P4 $9 XP@ @9r@$X@ C E<$W@)‰SPZ <$6P4$(Xx+@<$)Ãu6< <  ШuD$ $G`.^< <  ШuD$ $螠.^< <  ШuD$ $O.S^< <  ШuD$ $ "u C"uCu.U DM$R $u&.EDžTDžP$$D$tD$$d/V$7螟D$ D$ D$$֡D$A$/D$ $臞D$ $hD$ $Iu$Y%5t$d$D$ $ޝ.D$ D$ D$$轠$D$,SD$r$-:UWV1S1҃t<[^_]À?uEU<[^_]ÍE<$D$+DŽtڀp€P Шt.E1EU*€x Шu$t딀t€T ШtSE1뾃9EȋEUeȉU܋UE؋]܋EUE̋MÉM]܋]܉]5g€G ШtEUSm€M ШtEU/f€F Шt0 iM0 eUs€S ШtEU k€K ШtEU b€B ШtEU w€W ШEUqUVSU EEËE ։ؙ1؉1 u E [^]É\$t$ D$$&+EE [^]UEUEyM QEUE]UE]f@ ИUM]Q Q Q UU E]UU MƈQ]UU MЈQAƈA]US]$bU []UVSu$GU f[^]UVSu$6U [^]UWVES}uD$<$s]19uE 17F[^_]Ë\$D$E $pE 7F[^_]USE ]D$$[]USE ]D$$[]USE ]D$$[]U1WVS } u}1˃4$Ӄ9!ÉD$RU \$$T$藜)D$$D$-> [^_]UWVS]\$ߚ$觘@ E$蹝t/E} E؍E$跚U)‰`a \[^_]`a \[^_]U`a t Eɍ%|j`a E%|US`a ]=t)ÃOڃ[]/`a )ÍOڃ[]US`a ]=t)ÃCm8[]`a )ÍCm8[]UVS]u t.t7`` `` )‰uuҀ>u1[^]Ät>t1ꐐUS$(襘@E CC ECCǃǃǃǃǃǃ ǃ$ǃ`ǃdǃhǃlfǃǃǃǃ fC$J1$2f{DBK4C$<$Jp$JC(C fC(] ǃ $t ] ] []C0 S<TSS$eyda }1[]É$w~x C(b$+y$]da : 뻉$yda lUSE$TyxAEt$DFx0uED$$Oyx1҃[]Ã[]US] $x$u[]U] .u]UVSut7] CF4$D$}t$u1[^]Ã[^]á] [^]UE]] USE] $Jxx_E$FD$'UBЃCB0B4C BDB4C$B $eC(E@$$T1҉C,[]USMpt ttttp9t $`[1]É $J1[]UWV(Sl*DžD$:E$荒 1}уA U Dž҉DžDžEEEEEEDž $ * ? MA(@1 fDžDB$ $ )1fDžfDžfDžfDžf DžGȋExL1҉ȋfЍf)}f|$$u}G,Dž(G4׉,1҉fDž Dž$fDž0Dž4ffDž81DŽ<~fDž\fDž^fDž`DždDžt1fDŽhfDŽjfDŽxfDŽz~D$ D$$\UB,(Rd$BUBB$2MAA $NjEPx$҉VNMA Am‹} ‰GC W G CexteC nts CoverCflowCC(C,C-C@fCDCHCLfCPCTCXC\CdfCxC`1fDzfD|fDŽfDŽ~D$$6(ǃǃǃ$D$ D$\$QǃfǃfǃxfǃfǃD$D$$1fǃ$ǃ(ǃ,ǃ0ǃ4fǃ8fǃ:ǃ<ǃ@1ƄDK~$܎D$D$$蚒ǃǃǃf@FFcataF logF(F,F-F@fFDFHFLfFPFTFXF\FdfFxF`1fDzfD|fDŽfDŽ~D$4$s4,dždždž$D$ D$t$OdžfdžfdžxfdžfdžD$D$$fdž$dž(dž,dž0dž4fdž8fdž:%dž<dž@1Ƅ0DK~$辌D$D$$|dždždžfW@DžpUE=l*[^_]Ë}GZ$跏$誏}da sDž da OM DžA AD$$LDDžda ܊l*[^_]Ëoda 詊Dž K$蜎$菎D$D$$茎\$D$$7\$$D$pD$ $mDž MD$L$<$IoDžD$4$BDžda da $mUE$lx`ED$D$D$ D$E D$E$nh~+}uEU1da UE$ l1҅x EUSE] $kxEE19t8D$D$ D$\$$dd~ E1҉[]UVSE] u$kxPED$D$ D$D$E$d~$EtE4$D$6Đ1[^]ÁĐ[^]UWVES] $ k1҅xZ$x.U;uO@] lLJptu[^_]Ép㍅HD$D$D$ED$ \$$jfHukP]GD$LJlD$Y$^D$t$$NRGt$D$Ep$H~LU<$t&裊da 脆1da h1 <$c1UWVSuFuG] tl9$uda [^_]ËF .tҍV$PF9|0FF V $$61f~tDV$V 0E{lD$<$QF9EuJHT$Cl$2WH F VF da F .HD$D$ |$D$$`.(D$|$ D$XD$D$$^.(U |$D$T$ $[$l1cF da G=E HD$ ET$D$E$[1US$E$Hg1҅$:@D$D$CD$ C(D$E D$E$c{(udEǃCxD$$r*ǃUuڃ$[]É$Gda (1$[]da  1 ߉$1UWVS Eu}4$~/4$3CHHE tE 1)sfFzt1)sf } t4$2xMt t9t(4$KE [^_]EiE몉4$E [^_]UWVESEu $,e]t@D$D$$]uՋt$]uD$$d+] t $$$t ] ;] ;] $cU[^_]É$D$\d[^_]ËKC1SC<B1 ) fJfff|$D$$蕄]C(MKPfCDʀuUfS(hD$$cE] $] f fC(UV1S]@tE $D$&[^]É$_,yܾUE]UWVS,E D$ D$D$U$&EE9v)ȉEutzϻȁ )9vD$ .D$T$E$&xI\$D$$UU)މuE,[^_]Á,[^_]UWVS<E }@8D$ <$D$D$%uuE<[^_]$1$G` )Ӊ9v;v/D$$7<$&\$$T$D$ c/D$<$T$M%x>)؉;v$da /}<[^_]UVSE ]u D$ D$D$$s$U92v6@u72$}$E9C`v1 [^]da |UWVES]}u D$ D$D$<$#t0~\&tIda 7|[^_]Ëx*E9v‰[^_]ËE؅ۉt1ҍt&UVSE$_xbdh]D$t$D$ \$E D$E$Z~)E\$t$D$ d$R[1^]Á[^]UUE D$ B(D$BD$B$R1UVSE$`^x}]D$t$D$ \$E D$E$0Z~FE@u(E$D$St$$$W[^]da z[^]US]@u!E D$C($US1[]da FzUSE$l]dhD$D$ E\$D$E D$E$1YxMdtCu*taE@uA\$T$$$_[]da y[]da ryda [yUVSE $\S8D$D$ X\$D$E D$E$LXXf^%2E@\$uȍT$4$OD$\$4$D\$Ep$8xqD$Y`4$D$OD$\$4$C\$Ep$c8xLD$ D$D$E$O\1҅x! [^]da w [^]da wda w'da wUWVES$ZS(D$D$ HT$D$UE D$$pV!/EP|pD$$0Ep@HPVىP@|ƅHƅIƅLƅM}E$LPE$;`TfDždDžhDžlfDžpDžtDžx$w$|Eً|EfE1fDfDfDfD~܍(}T$D$E<$Lt$\$<$At$D$H$CD$E\$p$2x,D$ D$D$E$XY1҅>yĜ[^_]da tda tda tUVSE@$W<@D$D$ `t$D$8E D$E$Sb`@<E@8EEED$$$ D$$$| t$<4$D$JD$\$4$?\$Ep$3D$ D$\$Ep$2yda rda erlUWVES$UQxD$t$D$ T$E D$E$MQ1x]xD$D$ T$D$EU$T$P9]t \9tD$:U$t8tw4$T$p1ɅAĬ[^_]da pĬ[^_]Ëtt1x Uh>uID$D$ T$D$E$NL.rU9uda B`da &;Mt$$/uD$D$D$ D$D$E$I.+UB?u:1уD$BF$tEHt$<$D$TFD$t$<$:t$Ep$4/.|T$<$D$E\$t$<$K:\$D$x$R<|D$t$Ep$[+.jxD$\$ T$ED$E$#J. D$$Cs\$$\J.t1ɁĬ[^_]Í4$D$da  mD$\$ D$ED$E$MI.JhT$$gr\$$D$$CrD$ xT$D$E$Q.D$ xD$D$E$P.1EUda ;lda al$qda BlRda P3UE]@.UWVS Eu} 4$x24$?x&S4EKD1fC.E [^_]ËS4EED1KfC.E [^_]UEU H]ÐUSE] HQ9v' AD$ED$$m1[]É9v A)da EkUSEU HY9v% QED$$D$Wm1[]É9v Q)UWVSE]u EC0}9vitt$SC<}։]EE [^_]da XDj[^_]da oUWVSE]u EC0}9ttIfc($j$BSC$C<ЃClKE}]E [^_]da i[^_]da ܐU1]UWVS<DžE@ Q$D$jD$$X$D$mD$$[$D$IQ AAA AAAAƅA @ B BB BBB!B%ƅ),$D$0D$$p4$D$^8D$$L<$D$:@D$$(D$D$HD$$L$D$PD$$TPXP\P ƅd`f=STttf=MP K u t{9vaT$D$U$8<[^_]da fda da ۋ,u"UBB<1[^_]da UVS0uD$D$4$D$$F$D$4D$$I$D$D$$$D$D$$$D$D$$$D$=REt*=KLt4$x1ҁ0[^]F fuF4$yda dUWVS<UE}pD$ET$$"T$$E$ D$E$$D$E($D$vE*$D$dE,$D$RE.$D$@E0$D$.E4$D$CE8$D$1E<$D$E@$D$ ED$D$EFD$D$$@9E11ۃdD$$Eh$D$iElD$$xEp$D$`EtD$$HEx$D$ E|D$$E耍D$$3DhD$$~֋|91D$$s$D$\$D$E$D$ODž$ÖD$\$$~-91D$$Dž$æD$Z\$$B~-91BUG BGexteG nts GoverGflowGG(G,G-G@fGDGHfGPGTGLGXBG\BGdfGxG`GzG~fDŽfDŽ~D$<$LJLJBTLJU1@cata@ log@(@,@-@@@fBDBHBLfBPBTBXBB\BB`BdfBxBzB~fDŽfDŽ~މ$D$kBXǂǂǂ1ҁ<[^_]^UWVS,]}uD$D$$bCLpGTCzC~FLGXFzF~UB$D$GD$$G$D$G D$$G$D$xGD$$hG$D$XGD$$HG$D$^GD$$OG $D$G$D$$0G($D$EFD$$D$*@9GH$1D$GLD$$GP$D$GTD$$GX$D$G\D$$lG`$D$GdD$$sDh$D$`~苅|9q$D$D$$$1D$D$$$D$D$$~ʋ-91$D$$D$OD$$8~ʋ-9upUD$$D$xUB uUωB1ҁ,[^_]ËB@ T$D$$\UBZUWVS EUx,@0B< )9|{ $wZE t$|$U$zxu؃ 1[^_]ËUu6Eǀ [^_]da HY܉$]da Y UWVS EUx,@0 t$|$E$(xu؋U1b [^_]ø [^_]ÐUE Uu>BzǂǂB~ǂ]Ëǂǂǂ]UVSUM ]uutBHtBLBzt[^]ÅtBTtBX.t卂U1҉WVS}E q9؉Urp)1҅>9)ƃ~D$ \$D$<$2~da pW[^_]ÍED$D$D$ <$ULJ1ۋBBEED$ ED$D$$UUWVSEU4u 4A841s4fFD$D$4e@D$D$ yMDL$4$Z4[^_]ËM@BBF4<S4Eʃ[^_]fF]f&\$ D$D$$//CMD8fǁfǁfǁfǁ|$ HhA@D$<$D$+t$\$<$ t$HD$E$*8D$\$4$D\$4$2uDD$4$2da SCDL$4$2da ǍDD$4$\2UWVtSD$ pD$lD$E$U1ҋH4ltdp;d/+d1ҋu1ҋ\`d9ljr2UM1ǂtBB9Dž|sW1ۋU9sD~߉Ѝx|$L$ $D$-E9pdu`tvn4[UDž;`)`D$$0MfDŽfDŽ`t ~u|xEf\$$.`x\$ E|$D$u4$+MtBB됋EDdD$U$x/Dž|U\$ D$D$4$P+ Ĭ[^_]ÁĬ1[^_]da 1Pda Uf)f)ffj)\)֋Uf`fhhD$$.da tUVS]Bu u 1Đ[^]CzfCDfCPfCxCt$D$D$ D$C$D$J)~C(t$$+x 뇸낐UWVSUEZ0dۉEt ;<t؉ED$ .\$D$4$~EU}U<$D$E <$D$E<$D$蒲E<$D$耲E<$D$萲E<$D$~UBf#wcT)UUUtE\p\$<$;u1҃[^_]da ,Mda Jda hUWVS}OdMOEt ;<E싐tȃMuGMD$4$蘲G 4$D$色GD$4$/G4$D$GD$4$4G4$D$$Gf#w{ЋMD)ED_4$D$uED$ c/MD$G $D$][^_]da PaLda Jda pUWVS}LJ$x50=u xt'da KĜ[^_]ÁuDK8$t$D$t$(D$t$,D$t$ܯ0D$t$į4D$t$謯8D$t$m:D$t$U<D$t$d@D$t$Lt\$$yf8$JJD$$8$D$LLJx_$D$YLڍD$D$$uLtWx|4$0=uSuGb$Ia1҉da nIt $t&cMda ct$HMda )I H.?$M2UWVSu9u trI0=ut1ۍ0$t$<$D$(D$<$,<$D$0D$<$ޭ4<$D$̭8D$<$蔭:<$D$聭<D$<$蔭@<$D$肭3D<$D$!K~D$0$T$$NJ$.|xx$e0=unubD$|$$Ix$xCo1ҁĜ[^_]da Fda U1҉WVSu$E 9@m9tD$$E4$O.8A41I <Ë@9‰<x$D$HFD$D$؉$ID$ D$t$<$<$8uo|DžfDžfDž<$xe9<#1ҁ[^_]Í$]E! t* $y޺[^_]Ë| $=da D UWVS]E D$$Cu~CDCtdxx$|<$xtUT$E <$D$uxZCxxU1uĜ[^_]=u!ED$U $T$d Ĝ[^_]da CĜ[^_]C<da  D$t$ |D$DdD$$U i$rUWVSL](xD$ D$\$4$54$4$;y|fǃ$(04ED$E 4$D$ xEuB,1ҁL[^_]Éx|x4$8y΍D$|$ |D$$DdD$D$\$D$ 4$.4$.a|f$(|$4$ |$D$4$E 4$D$ED$E 4$D$4$L[^_]UWVS]E D$$St5UT$E$D$i Ĝ[^_]ËCDC4x~dFd$膤x|$xsE|$D$ xU $T$;xOU1 x~d.TCtD$Ĝ[^_]da )(@Ĝ[^_]da D$UT$ CD$CDdD$$EUVS0Dž](4$D$ D$E 4$D$*$fw$f,0[1^]fuf$BdTd$Т(4$Rda B>0[^]fpfǃ$ǃ(ǃ0ǃ4UWVS E]} (Cu]da \>1 [^_]É|$$CuAC.xDCPdDd$C$y [^_]=u uda =zda =뵐UEU U@P@@ Uf@f@P@f@dEE E]AUWVS E0@tz<1ۃv1Mt#9v؋Mٸu9tTEߋX:1@ [^_]da <da UVSEH΃ 3@[^]UWVSEE}EGwrffEtiUETWLGU+MzdZdt;UEMfDW9މUtGtuWfUEE;EEUfTGfG[^_]ÃEE;EmUWVS u>^t&D^xdPdtE $D$1ɉ^ [^_]UWVS Uu ]p9tSt$$D$=ED$؉$UtU [^_]1{ %KFD$ $T$UWVSME uQEyƒfUDA\yȍT0dȍD0d9s()@B\yȍD0d9rAfEEfA9~DQfDQ9\yËUuDdU E[^_]vtFx $x|$+x1ҁ,[^_]ËE D$U$MD$] \$E$,[^_]Ë|4IUWVSE ]uE$Cf"wЋ>TSO)9~Eu]E [^_]|$E$D$5][^_]8UWVS} U]GLGBTBCL9d)Dd $T$D$9OuDGtC)tf~t*AufGЉtfD^fDWF9}֋UBG<$xsMA94tp]Ct=xx|$x6G$6xu4$E1ҋEĜ[^_]ËG4{UWVS]} CDCDd$xC |u"s$Ĝ[^_]Íx$ .xK1#DKS)u H6)9E|$$D$ xD$D$|$ CD$CDdD$$IEBUWVu S ]} 4$D$}CD$4$mC4$D$襙D$ \$4$赙EtU [^_]USE] $\$-CD$E$CD$E$OE\$D$ $^[]UWVS] u} $D$謘FD$$蜘F$D$טFD$$袘UtU [^_]USE] $\$cCD$E$QCD$E$腗E\$$O[]UxEȉD$E$ED$E $E+EtÍED$EЉ$̙U8ED$E$KE؉D$E $9E+Et‰UE)uEU)‰UWVu SE }E4$D$MGD$4$=~t&b}2uG4$1ۉD$GD$4$G4$D$%G D$4$G4$D$GD$4$G4$D$ÖGD$4$賖G4$D$裖GD$4$蓖G 4$D$胖G"D$4$sG$4$D$cG&D$4$SG(4$D$CG*D$4$3G,4$D$IG0D$4$G24$D$G4D$4$D84$D$~C1ۋD4$D$~G 4$D$וGD$E D$ $Mt E U+E[^_]G4$1ۉD$GGD$4$7G4$D$rG D$4$cG4$D$.GD$4$G4$D$GD$4$G4$D$GD$4$ߔG 4$D$G$D$4$G(4$D$豔G,D$4$ǔG04$D$踔G4D$4$詔G84$D$蚔GE9EQut E;Es-da @![^_]1E뷋U EMfBf Uf)BDfZ.E]49v ى؉M9wEHP1[^_]da !u!UWVE MS@fADӍ<ٸڃ 29wEHP[^_]UWVSLu Et ED$:4$:… ШU::4ې8MȍE9>wE9Bt:u1:1>:ƋEtU:ED$UT$UȋET$|$D$ U$UEx4˿)MUȉ\$t$$#D]  EȉD$CF$a$uE:x .D$D$ U|$T$U$L[^_]da L[^_]D$D$ U|$T$$q.~Et UB UED$UT$ED$ D$UB D$U$QL[^_]ÃEda  $LD$D$ U|$T$UJ1}t E1}uC1uP>da yUȉT$E$"1nda 7yUS]u%`u-u5t=][] $ `tӉ$ tˉ$ uÃ[]UUu ] t1da  US]CuD$Y4$D$ \$|$4$\\$H$D$cD$|$ $nx5D$ D$E D$U$1҅x l[^_]Ál[^_]UWVSUEEUtىغ8uE}~ƃ[^_]U1҉WVSEU°vUbMUJ@EUpx|/M1Y0t-؋!Ѓu؋MAD9tfqDI1ҁ[^_]Éx|x$.xDžh9|9|.#$NfDžtNj|.Et$BdTd$2ex$!.Dž9|9|.$fDžtNj|.TED$BdTd$\t cJV Ё[^_]ÐUVS ]D$$\$1҅ut%=t1ҁĀ [^]D$$01҅.xۍD$ $\$1҃.t.tƄ($D$4$U] uÉ$rÐUUE uR w $]ø]]t&UWVS E0DxtLfzt9(?&,D$ D$t$$TA AAÀ8.-<+<- ШtDP!DXt[Àt΋7Àu7DX t)7Àtɉu@9& B4!DX t)7Àtɉƒ>{<{!Y&i8x1@=!DX t)7ÀtɋzIzxt}D$ L$D$<$D$$B!DX t/0ÀtÉw\B89t 1~ՋO L$D$ <$}$| [^_]Éf@~>tAO @D$] $£] O D$pD$@$O DD$ D$t$ $G;-'& SDX bw$(Bdf ?&f{G눋Bm@9&D$ $D$\$D$<$G4fRu@u@u@؉GuI@ D$D$D$ $$t*@ !@^G@8|؃3ۉ)ʉWybbXÀVDX Bxq  .8ӋDP .!9\unv#709utr&Z Tz.J  bf ՃvxDžxdEp Y0CЃw` CЃwE  D$|$$2ËZ hu@ u@ Du@ DžUWVS } ut,t(C<^w)ED$É$-uԄu؃ [^_]ËE$\D$ÍP$pE$rD$뫋E$fD$떋E$vD$끋E$nD$iE$tD$QE$bD$k9%D$D$E$8UB w$1AD$ $tfA fA A A ‰QA A  ‰U1WVSLE;O .UčR] 4E ^ K 9MUEȋDE̋DEЋD EԋDE؋DE܋DEDEEtzF>%E 9E>wLUEȋDE̋DEЋD EԋDE؋DE܋DEDEEdO 9U}.MčI] fxntnEl9U}f8uE9U1L[^_]ËU 1)ڹ}ȅ. EMȉT$؉ $D$Mċ] ICEf{xC H$(]^C E]^S UEȉD$$aS#C4=tV&!&1Eȉ$D$ S#C4=u;EE1{uK)‰.[yQEH^tfQ>y;Ed^]ȍK M<H;E3x# #E;E#E0 D$D$D$ $\UčR] D9;E;EUO SUt.Zu%O t9tH@uZ1O [][]UO O M 9tP@u]Ë@1]UVSuO t$${t[u1[^]Ã[^]USO D$GB D$ $[uރ[]USE$y1tS؃[]UE]HU]U]Ua ]ÐU*E`{5Pk %@[ %@[u1ÐU]U]U$h ÐU]U]U$u ÐU]U]U$ ÐU]U]U$ pÐU]U]U$ PÐU]U]U$@ 0ÐU]U]U$` ÐU]U]U$ ÐU]U]U$ ÐU]U]U$ ÐU]U]U$ ÐU]U]U$ pÐU]U]U$ PÐU]U]U$@ 0ÐU]U]U$` ÐU]U]U$ ÐU]U]U$ ÐU]U]U$* ÐU]U]U$4 ÐU]U]U$< pÐU]U]U$ E PÐU]U]U$@N 0ÐU]U]U$`W ÐU]U]U$` ÐU]U]U$h ÐU]U]U$r ÐU]U]U${ ÐU]U]U$ pÐU]U]U$ PÐU]U]U$@ 0ÐU]U]U$` ÐU]U]U$ ÐU]U]U$ ÐU]U]U$ ÐU]U]U$ ÐU]U]U$ pÐU]U]U$ PÐUVSt$rt11 t$M~4$=[^]U]U]UWVS,DžMkE$?SD$B U$;1$GD$D$1 $r~Ƃ|$D$$nD$#$tD$l$D$ D$ u=wwADQDž|$D$$c<$Q4$D$D$$1 y\ppu$pD$D$$$ ~$tEE$S{CbCgC$a,[^_]É,[^_]11ᐐU]U]UWVS utt4$uht$$q>tQ$[t?4${ CCC4C9C] [^_] [^_]ÐU@ ]U(E D$D$$D$yD$D$ D$D$x1Ut3@ ~,D$$7uË t tU1]UWV1SEUE} EEPh~59~\$ދED$$"UBh)9}&)D$ED$E$~~9|ڃ[^_]ËUE[^_]UWV1S,}2)=}Í\$$ 9|ʁ,[^_]UWVSUEƉEE E9u5_hx2P> tN9uwɋU[^_]AEt+F ~ED$$D$kYČ[^_]ÍUD$P$FED$P$rUD$ D$ D$$~+VtugE1D$$*E$F ~(UED$T$D$ UE$D$蟁U)=~-E눉c0UWVSEEEE E1}эY\$E4$D${9t EEEE[^_]UWVSl}Wht8E uD$ D$D$P4$#ډt$$ Al[^_]UMQhtD$$ UMQhtD$ $UWVS,E] uHh1ɋ} u'1 u1 u~,[^_]Ë.x㋁tى\$ |$t$D$D$D$$E\$$*U1WVS}] Ohڅ u~ 1[^_]Ë1\$ H$D$D$1D$耂\$$9[^_]US]Clu$ChCltx u[]É$%҉D$A$D>[]U1WVS}Wh2E ]D$ D$LD$P$Ɓ\$$REPWh]9E|r9]E E $}GlČ[^_]D$\$ D$D$4$E-E=‹Wh9.wO ~D$D$Y$|}WhEGD$\$ D$D$4$UyfE-E=ƋWh9. W .D$D$f$|<$Č1[^_]ËE맋E%UWVSl}Wht8E uD$ D$sD$P4$ډt$$yl[^_]UWVS }Wht4u}u\2x u 1 [^_]ÉD$&$ËGhǀ4$SGh [^_]É$HWhǂ덉$1Whǂi$WhǂEUWVS]|EE$D$D$ D$P~E\$$TƉ$1tEt$$؃|[^_]U1VSuM ^ht t v 1[^]$tAta΋t6뼸 뵸 뮸 막$^h릉$^h뱉$^hUSd]$D$P$D$ D$ D$!d[]UWVS|}Wh_@G,CDžD$DžCD$C D$CD$CD$D$@D$ $}ƋC D$D$CT$5}s CHt$D$$s9t +~3D$D$$s;t $ƅC)CaC QC$AC(1 CLCL~-D$C+$$F1C>tt$$~1|[^_]ËC.=@D$D$${Dž^1C 됃 CL "UWVSDžUEr,@z Zƒ Шd[u^hM u D$:E $E pE hu D$D$t$ $BzD$:$|t |D$p$ IO ߅D$@$i)=v\$D$ D$D$$~ytE@ ~-|$O tT$ D$$D$v$p`$o8uO ۉl0]4$)D$D$D$ $Z$D$$tD$$$!u$IuFtu!Ĭ[^_]$YuL\$|$D$D$T$ $w볋UBttD$D$$w$ ‰Fh1.xBǂǂǂǂǂǂǂ$D$hׅnUBh8B t |oD$ D$D$P$v\$$ExgE hEEËE\$D$ ht$E$_UBhDžǀĬ[^_]D$$O $O 3D$H$r$rO tIDžpt$D$%$\rxDžl7YD$;$lrB$jW9t$FQ9tG$Tp$vCD$pD$O tT$ D$O @D$$uFtsD$pwD$$Wt$Kq%GD$$mD$+qD$$D$$D$$slD$/$tXD$pt$tD$ D$\$D$l$lt$$wpQ$@UUM tM UH]* t~ t1]ø1 UWVSE E ] tu t=U $T$UR xCD$ C D$C$D$a\[^_].tE볋EUE]JUVS] u\$4$P9É ШtˉNT^X[^]UVS] u~\$4$9} 1[^]Ë\$4$PFp[^]US]$PCp[]UE]J UE]J(UE]J,UE]J0UU EPd]US$]E$D$phD$ $etaD$?$Hzt $[]D$$'zuD$F$zuD$$y1҅t$UEP@B uJ$uz(u1z+t]UE]@@@UE@@Px@])Ë@]UWVSEYEuX@C(D$t$D$ E $pxe} )ǀ{(xi{)C(vL C(f%f=ET$ D$D$t$<$apx+U [^_]$@C)D$t$D$ <$(p.x)ƀ{)pC*D$t$D$ <$o.x)DE[J?85=+!Vk {UWVSE] uD$ D$\$E$hoxV}(UD$ UD$>\$<$9ox3)ÃyD$Y\$<$ox+U[^_]Ã[^_]UED$D$ED$ E D$E$3UWVSE}u X@C~Ct +E [^_]ÉD$CD$|$D$ 4$xn….xҋu C)փd~dD$D$|$D$ 4$….xUE@@P TD$D$ ET$D$E $kɉ!UWVS|EEux@G t:t*]D$ D$D$@$mڋMADt8tEEM T$D$D$ t$L$G$$tx9] )ËEt$\$$x)ƃ G(u+U |[^_]ËGLt$$D$ G+ED$.x)ƍG(D$MED$L$ t$\$$W.x땅<GMbD$EH`Y؍])‰T$D$D$@D$ $ZlMt$\$ $J.)U1҉WVS,}]G(~oG@@D$GD$G D$GD$GDD$,\$D$ E $kx,u )É<$Ɖ\$t$x)Ã(+U ,[^_]É\$t$<$.xƉ+U US]K|+St$L$)ЉD$&C|[]UWVSEu X@$NjC~Cu +E [^_]ÉD$C|$|$ D$ED$pD$4$j….xNju )Uփd~dD$D$4$D$ ED$….xUMbWVS}uG@@D$O`Y)‰T$D$t$D$ E $Qjx] )Ã(+U [^_]Ét$\$<$.xUWVS}]<$M tE 0t2G$~W(t'E<$D$ED$xq])EËG$~G(t7G@xt+|g@D$$D$ ED$}ix,)EG(~*E\$<$D$xÉ+U[^_]ÅyG$ɋED$$D$i.x)EG@nUWVS]Es${(C$C(D$ E $D$D$s${([^_]UVSEu D$\$$~D$\$4$\4$[^]UU$D$US]K|+St$L$)ЉD$ ED$ C|E[]US]$][]UVS]D$t$$~$D$t$$[$[^]UWVS }u]E D$D$D$>D$<$fyE Y} [^_]fUED$ E D$ED$ $UVS EX@$ƋC~Cu [^]ÉD$Ct$ t$D$ D$p$#fd~dD$$D$` [^]UMbVS ]C@@D$K`q)‰T$ D$D$ $e{( [^]]$ [^]\USEX@C~Ct[]ÉD$ CD$D$ $IeCd~dD$$D$[]UE@@P T$T$D$YUWVS }E u]D$D$<$dx'B^w/T$D$\<$dyE Y} [^_]dD$h<$}dUED$ E D$ED$ $[UWVSE] uD$ D$\$E$dxX}T$ D$\\$<$dx5)Ãx8EEB^vD$h\$<$mdyˉƒ[^_]D$Y\$<$Id.xۍ+U[^_]UED$D$ E D$E$qUE D$ED$ $UE]@@@(UVSEX@$n1҅tC+$F$.LF >Y>F$uF #F UEU t~ t~@ t1]ø U(E D$D$$D$0D$D$ <D$D$R1K1UWVSEPhEEEB EE}Ph17DZx$ZEPhfDZ~׃E}~ȃEm老}~>t"$$UBhǀǀ1[^_]UWVhS]t$$\$[ux%=`t 1ļ[^_]Ét$\$$ux%=XD$\$$y E1󫍅XD$$Et4D$$Dt t~ڃt&t-Uȅt&duBeu BvuB\D$C$=UD$$)UD$$UD$$UXD$$D$Z@=ƄXf1WX/I߹򮍽XʹэL $ \$$򮋅р|/D$/$@@X|$$D$PD$$X|$1$1tI.u B.uBuDŽ~ DŽ uDžt1t1򮋽tэ<9t~Ջtu Džtt=x91ƅH t1HfDŽ)G/D$H$4벉|$$h1uӃ $B=7HXƄHL$<$&X\$D$Y|$ $T U̹|ֿ t,|iuBdu BeuBED$ D$ D$$D$ D$ D$1)ЉEԃ$PD$ D$ D$1)ЉE؃$D$ D$ D$1)ЉE܃$M̙|1)ЉiuAdu AeuAt( |(׃B()1ɋph =N $<t%9uN!;u;u~pD$D$0$PD$|EЅu1||\$ D$D$$Op.dJhf|AT$t$ L$\$D$$^O L$D$ẺT$L$ D$D$Bt$[QXT$\$D$ D$D$NT$ \$D$Hu fDžH/$xPfTAq $Јq Qhr!r $Ȉr E 0EE  T$$T$D$ẺL$(t$ t$L$T$ D$D$$P{b||HQ҉:Dž(‰(‰҉Xщ $.XD$$i|sD$S1D$$DtB ~*D$lD$ D$$SOD$SD$ $#̉@ 򉍀~BL$T$t$L$ D$D$($N򉅌ǹ򮋅DM|\$ |$f/LADžUWVSEU@R EEUX@,E}ƒ} Шu~)4UBtFČ[^_]ËExhou tu t$U :}1}ED$D$D$ $UD$D$$T$ $߹EE%KE$D$ ED$ED$EMEEEUD$$dEx ~U|$ \$D$D$\$3La] t<u ttEx ^M t E 8Ed$IUB,$I$IE$荼EE 놐t&#ttt Ex vƋ >u\$D$HU$:KD$|$ \$D$U$Ko<$蘸b$ ׹UƉBh1.Ydždždždž fdždždž1E~ 1ۋEMph1ҍfDF~~m~U\$D$T$UD$T$ $JD$$;xtED$ ED$ED$E $EEUD$ E$D$ED$3EE!D$$IUBt>tU D$D$T$ $J1Uz >~"D$|$ \$D$$2IU$ UBtD$$HvU]U1VSU w5EXh1t)11ҍf|Cy~~1[^][^]U1VSM ]u u71 u&!EPhtDB[^][^]UD$8E@t$GUEP@hP $t1҅‰]U1U tBwE SU]遺]UWVSuF^@x{ ~C C$1ҁČ[^_]ÍExD$D$,$eED$D$@<$MECCDECtEC 1҅~DTD9S CEȋEċC@ƅ8iCD$S}ЉE܍ED$F$耹 Ct43M9t+EȋS9vЉD$L$4$諷EȋS9v)ЉCC xC(CE$EtCLxC+|C/EC3EC7EC;EC?ECCEC(CGE@tuC C( u,C$tb.+ƒ  к. DC$~ |$D$\$vEUЀ:uztC$UWVSU] t3rht0Rx9t%t~A tt;1[^_]Ã~ .t~ u߃[^_]ø>  䋶 .xQ)ڍRȹhЉ)‰T$ )ډi'U)É؉)L$ED$D$D$ $O DO 9US$] D$D$$D$6D$D$ YD$D$5$D$D$D$6D$D$ YD$D$4E\$$=$D$D$D$6D$D$ D$D$Rw4$[1]UWVSÃLUUu}xDЋM)‹E UttL[^_]ÍEMD$SD$ $螵1҅u֋C ~$ED$rD$ ED$$BED$SD$E$SẺUԉMЉE؁{ U~0D$EԉT$D$ EL$D$D$$@BEUM EԋUЉMtE܉.U؉EgUWVSEPhEEE9tLfDŽBE}17DZx$3EPhfDZ~׃E}~ȃEm䀁}~>t"$EPhǂǂtXxNfDŽBE17DZx$虮EPhfDZ~׃E}~1[^_]USÃD$$ı$D$D$譱[]UWVS<}Gh NBE EEEE1kUt$ T$U<$T$P$.x׍EED$r"D$$Ͳ.xE9E~ED$u"D$$覲~E}{E}cE ;EEEE1kUt$ T$U<$T$P$.x׍EED$r"D$$.xE9E~ED$u"D$$~E}{E}cEE1Ut$ T$U<$T$P$xcED$r"$D$舱xH_ ~6EUt$D$ET$ D$ED$8D$$>E;E}EqE}aE}I]Gh>yt6xW;t x ؃<[^_]ËU 9|U t&UWVS u} F ~|$D$$=!Í8$t1tFhVlډЃ [^_]US]Clu Cl[]É$Cl[]U1VSU w5EXh1t)11ҍf|Cy~~1[^][^]U1VSM ]u u71 u&!EPhtDB[^][^]U]US]Sh9CtAu3ED$"ED$C$x 1Ƀ}[]UWVSLE] PhpE9PtBE}D$"|$4$趮x1҅ttstKL[^_]ÍU1ׅEPEZttLMƒL[^_]E|$D$"4$;1҅yEt&׉T$D$4$貨USÃU$親‰U҉Ut ЉEED$"$D$íx[]$8[]UWVSP4|$D$$蕪x%=`D$<$蛫D$D$<$~XD$D$$$1V8Dž\$ CXD$<$D$轭t!谨 vtt  tD$<$D$[^_]UWVSLUE@h GxG xwxEEU؉D$ED$ED$ ED$ED$E܉$Mu MMw~Whrf f9tD$d$[6u܉؃E>u~_ ƉE܅~rEt$D$D$ $8u܁vN1L[^_]1ҋ_h9t%SfufSЃE.twU.xEE.xMȋ_hЍf|CEYMԅ-;uMȍfDCE؉$豥?frmǀ ED$"D$$蜪.*Ghu G,QD$)ڍRȹhЉ)‰T$ )ډi'U)øQ؉)L$ MЉ$L$V7;U  E;EU؉=GhU؉G1{U؉Gh'U؉MfLCUWVSDžPDžLUBJ Z=X\ƒ` Шu~+!MQtn[^_]ËE tUE tKqÃAuU BTu BAuBuDžLE MAhL`} tM 9uwX1\u]L1P1ۅ1P~ UBttPP~ UBttE M 91DžT} M D$ $'=7TډD$`D$D$\D$ D$X$El`UD$ \$D$XD$`D$\TD$Xډ$EL$ rEDžDpPx Hƒ Шu H"趢MAt>t*H|$t$ T$D$D$$4PEX DžTDž<UT1ۋBhHL$D$4D$ $3<1EPh7DBft0Tt$D$\$ T$D$HM$<3~~TtM D$D$L$ $Q313]u `U BaTGDžT8MD$D$L$ $e;ED$D$$D$ $sE1..D$4$x{`ډD$\D$ D$X$E.\Xy`PE.4tUBt>tD$D$$1.t.ttMAt>tt$ D$D$$1E$WEHh1f fAyUB ~&D$D$$0EHh>y ǁE t U :1 _HQ19`U|$ D$$D$ 0MD$ $EHPh>f\B$ 躞1ۉEɉHh.O1Lǁǁǁǁ fǁfǁǁDžT1T1fDŽQ12fDA~~ჅTT~`D$D$D$\$D$XD$ x/WUB,>tD$$.ME  D$ $  ED$D$D$ $`E1D$4$7dD$"$D$Ӡ7FڃaD$ `D$\D$X$Em\Xy`PEt 4OM ${UBt>tD$D$$.$뮋UBt>tD$D$$-ћ.z.p.f ])hDžHD$D$ D$$ÙhD$T$ D$$$蝙lDž@tƍFD$ D$ D$$蚜D$4$HSEDPhf\Bl@t @4uh $D~ UBtt} hM 9\H1.D$ $裝1} U Dx1 MAhHf\PL$ |$D$E$DDTUMBtu1@UBttM L$ D$D$$+΋MAt>tD$D$$w+c..UBt>tt$ D$D$$*+h $]KDU$fUWVS4Dž@4Džr@0~ 4Yh9AV4;P4t04Zh;,(4@ ~)FD$ D$D$4$)V~l4YhtV,(;~4ח [^_]ÉЃ$)(V$,_$FDž $$$$ D$D$$,$&,$  Q4AhQ,H61D2T,D $9|Fu),T8$9tFT$D$$D)~_$\$,T$0 $~9t!\$ D$4BD$$D$X%4Ah9,@ D$T$0 $TOFt",$;tFD$$D$(,B F F$z pFF)$F,x4B(~FB ~?,AD$A D$AD$AD$ D$LD$$&4P49Vt 01[^_]Í$F,xbF+N(FLD$D$,${'V$,F$ F F$yHAX<$4X ‹@XD$ BhD$D$$%4Yhw.F(8D$D$l$#F+8FDž@<DžHDžDƅVU$ЉڈF4x F+TFLTD$$(D$,$ &(,NDž 4$|~!4A`9|Mt@F H4B`uF(F$F "4Xh9H}F$F 4P40UWVSlEE]Cs@xChf~'l[^_]F F$1l[^_]Í}D$D$@<$!ESF>EF EFEFEEFTEF+EiFMEĉ|$D$"C$ NjC ~|$D$$K#iEԈF(E׉FLK ~&EډD$ ED$D$$#E؃vFE E$eC`U9}LF$F F tF$uF$E܉F1E1~EF 볉$~~C`uF(F 독ZEtV$uF$~+i~(_FLuFL~-~7u{~8uuF(F+FL' F$ƒ Шt ChfxCN$ƒ Шu RxxF(fǀGUEU t~ t~` t1]ø U$1U1]UD$${UD$$ZUYUA1U,1U]U1]U]U]U1]UU؎ÐUU EP4]US]C\uEC`uMC@uUu]ueChum$0Ctuu][]t$lC`t$]C@t$Nt$<t$*Cht$$軭Ctt$][]US$$1҅D$D$$@ D$ D$D$$CC4CL$蹍C\$袍C`tp$l菍C@t]$|CttJCxC| $$Ut $?څt[]É$1[]US]$$1[]UVSut5 $0迌t$$P趕t$$P$1[^]UWVS\DžDžE DžDžDžtE UP EC,Eƅt U:9t5 D$`$D$ D$D$$M1}U~4CD$C D$CT$D$<D$  $$D$赩څ\[^_]ÉTPuquVD$:$, u7+u~t$U$T$贎Ƅ5G<@D$,$諈W.1DžDžDžDžDžDž1:c]1ҁ\[^_]ËU D$YT$$uRCD$C D$ CD$D$ $gD$ D$D$TD$hD$ $ 덋BDžDžDžD$D$D$ D$E$D$蟌UEB<(<: ШtSD$:E$衆t6D$:$~. Uƅ D$U$T$EDžDžD$,$@E .D$wUT$E $<1E t Ct$R1<,iD$4$S8EԆE .kt$ D$ED$U $1H} t8D$D$D$D$ UT$E $m$D$8,E .tыD$D$ UT$E $B瀽DžDžD$E$D$ED$ D$UT$E $iA9. $D$0,„ Шt8t1G $D$]8u-(} .sD$D$ u .PD$D$ zUWVS]u }uUCs{ S[^_]ËE|$t$$D$ R$UsC{ S[^_]ÐUWVSME] ɋ}1t9tdu ~݃@MpU1u"9\$ D$ED$<$[^_]B;EuB[^_]É\$ D$UT$Ń .UEwN@ AED$@ D$ ËED$@ D$ 벋ED$A D$ = . UWVSEEEEEDž|DžxDžtDžpDžlDžhDždE,u $vu$4$E |$D$E${xσ [^_]UWVSEu} E t:E)Dž~/t$|$E$8u}t[^_]ËE[^_]ËE$UEEED$ED$E $1Ʌt;ED$D$E$x1ɅxET$$D$ÐUW1VSE] €  Шu+-Uu0E t"A< w30;E}} uދEtߋE 8[^_]ÍAq<< Ш.tω<w7W뤃 qE _E x€X ШSE cU E D$D$E$U ED$E$MU ÐUWVS$EE}E €  Шu+-Uu0E EE؉ULp;u}uE]ue]܉щEЉً]]EЉUEMԋUUt4A< vAY<€ Шtpvp;u|Et ]U]E UMH$[^_]Ã!EEx€X ШEU E D$D$E$mÐU$ s¸tEBE BQ Q 1USQ ]tB$D$RQ £Q u$ vUWVS u$ 4$q}$ … 1Ҩu [^_]UWVSÃL xN4$tbU T$UD$|$T$ $B u L[^_]É4$L[^_]ËE D$ U|$$B T$Eȉt$ D$B D$$oEwUEUD$E $16US] zU\$$1[]UEUD$E $US] 0U\$$¸[]UE D$B D$ ED$ $ ÐUVSM EUxt y؉ É ÉЉу‰~?yӃ~ [^]È[^]ÐUoÐUVSÃsP)‹ЃT$t$ $xsf[^]ǃsf[^]UM UAAff~]É]nUS$fDž EEE D$ E\$$P*D$$f~ E$[]ÉE$[]US$fDžEEEED$ E \$$P*D$ f~ E$[]ÉE$[]USU ]JAB~ []ÉJ[]US$E] $p+EE]D$ ED$ED$% ۉtEMxЃ$[]ÐUWVSuU M9 ШuaރyJ  ШumʉEыuڃ~sy[^_]ÃЃ[^_]␐UVSÃsP)‹ЃT$t$ $\xsf[^]ǃsf[^]UM UAAff~]É]nUS$fDž EEE D$ E\$$.D$ f~ E$[]ÉE$[]US$fDžEEEED$ E \$$.D$J f~ E$[]ÉE$[]UVSÃtK u[u1[^]Ét$C $.t݋S1t݋E D$CD$E$SUWVS ]u Njt]WtVttRډt$$aB t$$F?t .uu1uD$D$C $yg1\$$уL$VgD$D$$:gi [^_]ÐUWSE] R R R t= R t$GlE1}у  R R UE [_]@m $Hh£R uڃ[_]UR ]UR ]UR ]UWS R ]t=@R t$k1у w@R  R \$$l[_]É $g R uU R u R tuD UWVSÃLۉxA$tfUT$U t$ D$T$D$B E<$D$L[^_]ËED$U t$ D$B T$E<$D$L[^_]É\$ ]D$B D$$tUMEU L$ML$M $+US]U\$T$U $U[]ÐU%fUɉÐUSU ]JAB~ []ÉJ[]US$E] $p3EE]D$ ED$ED$%ۉtEMxЃ$[]ÐUE U]UE$3EED$ E D$ED$UÐUS]M … 1Ҩu8uu[]1[]ÐUSU] Mtaw3$C  utt []D$$T K1[]Á 볃 @ 먁  뚃  돁 넁  s hUWVS]}58^ tcuu>t$$F؃[^_]D$ D$D$$ctD$$d뭉 D$E $Qbxu1늋E $b1xUWVSEUB:EEBX~EUJuR$xM4$L$׃yED$E$׋UBtM$ L$׃yE[^_]USӋR ȃ uS []USӋR ȃ uS []USӋR ȃ uS []UWV}S_ 1҃ Ɉu_ [^_]UWVSEEB}EU1FуMV,M~ E+}~}t,~$ t&V(:tED$$V(UV(:uFuF$x؋U$T$UyF,t~$ tsE>E$0D$UmyUtMEL$$UUu^tM$ L$UyE[^_]ËV(:.tML$$V(UV(:uaF9)ȉEvUVSøC t1N؅x&ȋVx t  yF[^]CUWVS DžDžEU uDž%M $L$U<%u׍ƅ1҉DžDž DžDžà w$C Ĝ [^_]À*DžӃDBЉC< v݀.Dž$C |$]U$C |$]|$$C ]ƅIt)>$C ‰D$f]BCwC$C 0EEۉM9MɉUtE܉EEEUMHEU0^_É;}vUM̉UMEUEU0^_ǃEua9}w9urŰE)E܉ŰUtE܋ỦEUMEUQ녅u 1ƋẺE܉U= +EԉE؉MMM׊M؋U E̊ME̊M؋E ẺE̊MUe;ỦEw uE9Ev M)MȋEM̋E+EщM̉ʊMMԉE ‹EUEUWVS [ ~J E)19s׉M)F9Ήr [^_ÉUWVS[ñ  ) pNu. [^_ÐUSRW W  vЋuX[US[K PnQY[PREPPUBLAPPICOPYBIBLABSTVOLSVOLISYSIHFS_TYPEHFS_CREATORunixTEXTSTREAM.IMG;1TRANS.TBLboot.catalogLINUXCDROMnobakDo not include backup filesno-bakabstractSet Abstract filenameappidSet Application IDbiblioSet Bibliographic filenameno-cache-inodescheck-oldnamescheck-sessioncopyrightSet Copyright filenamedebugSet debug flageltorito-bootSet El Torito boot image nameeltorito-alt-bootsparc-bootSet sparc boot image namessunx86-bootSet sunx86 boot image namesgeneric-bootSet generic boot image namesparc-labellabel textSet sparc boot disk labelsunx86-labelSet sunx86 boot disk labeleltorito-catalogcdrecord-paramsPARAMSMagic paramters from cdrecordomit-perioddisable-deep-relocationfile-modefollow-linksFollow symbolic linksgidgraft-pointsDIRold-rootPrint option helpGLOBFILEHide ISO9660/RR filehide-listhiddenhidden-listhide-jolietHide Joliet filehide-joliet-listhide-joliet-trans-tblhide-rr-movedguiSwitch behaviour for GUIADD_FILESNo longer supportedinput-charsetCHARSEToutput-charsetiso-levelLEVELjoliet-longjcharsetfull-iso9660-filenamesmax-iso9660-filenamesallow-leading-dotsldotslog-fileLOG_FILEExclude file nameexclude-listno-padprev-sessionSCSIdevomit-version-numbernew-dir-modeforce-rrno-rrno-split-symlink-componentsno-split-symlink-fieldsSet output file namepath-listSet Volume preparerprint-sizePUBSet Volume publisherquietRun quietlyrational-rocksectypesortsplit-outputstream-file-nameFILE_NAMEstream-media-size#sysidSet System IDtranslation-tabletable-nameTABLE_NAMETranslation table file nameucs-levelSet Joliet UCS level (1..3)udfGenerate UDF file systemdvd-videouiduntranslated-filenamesrelaxed-filenamesno-iso-translateallow-lowercaseallow-multidotuse-fileversionverboseVerbosePrint the current versionSet Volume IDvolsetSet Volume set IDvolset-sizeSet Volume set sizevolset-seqnoold-excludehard-disk-bootno-emul-bootno-bootBoot image is not bootableboot-load-segboot-load-sizeSet numbers of load sectorsboot-info-tableXAxatransparent-compressionhfs-typeSet HFS default TYPEhfs-creatorSet HFS default CREATORappleAdd Apple ISO9660 extensionsCreate ISO9660/HFS hybridMAPPING_FILEmagicprobemac-nameno-mac-filesboot-hfs-fileSet HFS boot image namepartGenerate HFS partition tablecluster-sizeautoSet HFS AutoStart file nameno-desktophide-hfsHide HFS filehide-hfs-listList of HFS files to hidehfs-volidHFS_VOLIDicon-positionKeep HFS icon positionroot-infofinderinfo for root folderinput-hfs-charsetoutput-hfs-charsethfs-unlockLeave HFS Volume unlockedhfs-blessFOLDER_NAMEName of Folder to be blessedhfs-parmsPARAMETERSprep-bootchrp-bootAdd CHRP boot headernetatalkethershareexchangesgiLook for SGI Macintosh filesmacbinsingleusharexinetdaveLook for DAVE Macintosh filessfmLook for SFM Macintosh filesosx-doubleosx-hfsmkisofsUsage: %s [options] file... Use %s -help FROM: '%s' ESC: '%s' Cannot open '%s'. MKISOFSRCHOMEUsing "%s" Publisher string too long Preparer string too long Volume ID string too long Bad mode for -new-dir-mode %s:%d: name required System ID string too long Bad value for -uid Bad value for -gid /dev/nullMissing pathspec. Read error on '%s'. Bad mode for -file-mode Bad mode for -dir-mode defaultANSI_X3.4-1968iso8859-1mac-romancp10000%s linux-gnui686 %s (%s-%s-%s) Rock Ridge signatures found GRAFT:'%s' Joliet tree sort failed. Max brk space used %x %d extents written (%d MB) RRIP_1991Acan't open logfile: %s NO Rock Ridge present AA signatures found XA signatures found wbUnable to open /dev/null scan done Invalid node - %s Can't have -auto with -apple No pathnames found. Options: %s-%c-%s-%s%sIllegal Volume Set Size %s Not enough memory MKISOFS ISO 9660/HFS FILESYSTEM BUILDER & CDRECORD CD-R/DVD CREATOR (C) 1993 E.YOUNGDALE (C) 1997 J.PEARSON/J.SCHILLINGCache inodes (needed to detect hard links)Do not cache inodes (if filesystem has no unique unides)Check all imported ISO9660 names from old sessionCheck all ISO9660 names from previous sessionStart specifying alternative El Torito boot parametersSet El Torito boot catalog nameOmit trailing periods from filenames (violates ISO9660)Make the mode of all directories this mode.Disable deep directory relocation (violates ISO9660)Make the mode of all plain files this mode.Make the group owner of all files this gid.Allow to use graft points for filenamesSet root directory for all new files and directoriesSet root directory in previous session that is searched for filesFile with list of ISO9660/RR files to hideSet hidden attribute on ISO9660 fileFile with list of ISO9660 files with hidden attributeFile with list of Joliet files to hideHide TRANS.TBL from Joliet treeRename RR_MOVED to .rr_moved in Rock Ridge treeLocal input charset for file name conversionOutput charset for file name conversionSet ISO9660 conformance level (1..3) or 4 for ISO9660 version 2Generate Joliet directory informationAllow Joliet file names to be 103 Unicode charactersLocal charset for Joliet directory informationAllow full 31 character filenames for ISO9660 namesAllow 37 character filenames for ISO9660 names (violates ISO9660)Allow ISO9660 filenames to start with '.' (violates ISO9660)OLD Pre-POSIX.1-2001 option - don't use -LRe-direct messages to LOG_FILEFile with list of file names to excludePad output to a multiple of 32k (default)Do not pad output to a multiple of 32kSet path to previous session to mergeOmit version number from ISO9660 filename (violates ISO9660)Mode used when creating new directories.Inhibit automatic Rock Ridge detection for previous sessionInhibit reading of Rock Ridge attributes from previous sessionInhibit splitting symlink componentsInhibit splitting symlink fieldsFile with list of pathnames to processPrint estimated filesystem size and exitOLD Pre-POSIX.1-2001 option - don't use -PGenerate rationalized Rock Ridge directory informationGenerate Rock Ridge directory informationSet output sector type to e.g. data/xa1/rawSort file content locations according to rules in FILESplit output into files of approx. 1GB sizeSet the stream file ISO9660 name (incl. version)Set the size of your CD media in sectorsGenerate translation tables for systems that don't understand long filenamesGenerate DVD-Video compliant UDF file systemMake the owner of all files this uid.Allow Untranslated filenames (for HPUX & AIX - violates ISO9660). Forces -l, -d, -N, -allow-leading-dots, -relaxed-filenames, -allow-lowercase, -allow-multidotAllow 7 bit ASCII except lower case characters (violates ISO9660)Do not translate illegal ISO characters '~', '-' and '#' (violates ISO9660)Allow lower case characters in addition to the current character set (violates ISO9660)Allow more than one dot in filenames (e.g. .tar.gz) (violates ISO9660)Use file version # from filesystemSet Volume set sequence numberExclude file name(depreciated)Boot image is a hard disk imageBoot image is 'no emulation' imageSet load segment for boot imagePatch boot image with info tableGenerate XA directory attruibutesGenerate rationalized XA directory attruibutesEnable transparent compression of filesMap file extensions to HFS TYPE/CREATOROLD Pre-POSIX.1-2001 option - don't use -HMagic file for HFS TYPE/CREATORProbe all files for Apple/Unix file typesUse Macintosh name for ISO9660/Joliet/RockRidge file nameDo not look for Unix/Mac files (depreciated)Cluster size for PC Exchange Macintosh filesDo not create the HFS (empty) Desktop filesVolume name for the HFS partitionLocal input charset for HFS file name conversionOutput charset for HFS file name conversionComma separated list of HFS parametersPReP boot image file -- up to 4 are allowedLook for AUFS CAP Macintosh filesLook for NETATALK Macintosh filesLook for AppleDouble Macintosh filesLook for Helios EtherShare Macintosh filesLook for PC Exchange Macintosh filesLook for MacBinary Macintosh filesLook for AppleSingle Macintosh filesLook for IPT UShare Macintosh filesLook for XINET Macintosh filesLook for MacOS X AppleDouble Macintosh filesLook for MacOS X HFS Macintosh filesto get a list of valid options. %s:%d: equals sign required after '%.*s' %s:%d: field name "%s" unknown Illegal UCS Level %d, use 1..3. Boot image load address invalid. Warning: -follow-links does not always work correctly; be careful. The option '-P' is reserved by POSIX.1-2001. The option '-P' means 'do not follow symbolic links'. Mkisofs-2.02 will introduce POSIX semantics for '-P'. Use -publisher in future to get old mkisofs behavior. Warning: --osx-hfs only works on MacOS X ... ignoring Required Eltorito boot image pathname missing Volume Set Size > 1 not yet supported Volume set sequence number too big The option '-L' is reserved by POSIX.1-2001. The option '-L' means 'follow all symbolic links'. Mkisofs-2.02 will introduce POSIX semantics for '-L'. Use -allow-leading-dots in future to get old mkisofs behavior. Bibliographic filename string too long HFS default CREATOR string has illegal length. Copyright filename string too long Abstract filename string too long Maximum of 4 PRep+CHRP partition entries are allowed Warning: -no-mac-files no longer used ... ignoring Required PReP boot image pathname missing Application-id string too long Required generic boot image pathname missing Required boot catalog pathname missing Option -%c is reserved for future use. Boot image load size invalid. -i option no longer supported. Volume set ID string too long -stream-file-name not yet implemented Illegal iso9660 Level %d, use 1..3 or 4. -sparc-boot and -sunx86-boot are mutual exclusive. HFS default TYPE string has illegal length. Unknown charset Known charsets are: INFO: %s character encoding detected by locale settings. Assuming %s encoded filenames on source filesystem, use -input-charset to override. Unknown HFS charset Known charsets are: Warning: ISO-9660 filenames longer than %d may cause buffer overflows in the OS. Warning: Creating ISO-9660:1999 (version 2) filesystem. Warning: using transparent compression. This is a nonstandard Rock Ridge extension. The resulting filesystem can only be transparently read on Linux. On other operating systems you need to call mkzftree by hand to decompress the files. Warning: transparent decompression is a Linux Rock Ridge extension, but creating filesystem without Rock Ridge attributes; files will not be transparently decompressed. Warning: creating filesystem that does not conform to ISO-9660. Can't have both -apple and -hfs optionsCan't have -hfs with -sparc-boot/-sunx86-boot Can't have -hfs with -generic-boot Can't have -prep-boot with -apple Multisession usage bug: Must specify -C if -M is used. Warning: files from previous sessions will not be included in the HFS volume. re-directing all messages to %s Warning: creating filesystem with (nonstandard) Joliet extensions but without (standard) Rock Ridge extensions. It is highly recommended to add Rock Ridge Warning: Disabling Joliet support for DVD-Video. Iconv charsets cannot be used with Apple extension, HFS, ISO9660 version 2 or Rock Ridge. ISO9660/Rock Ridge tree sort failed. Implementation botch: %s should start at %u but starts at %u. Implementation botch: FS should end at %u but ends at %u. Done with: %-40sBlock(s) %d Writing: %-40sStart Block %u Cannot use XA, Rock Ridge, UDF or Joliet with -stream-media-size Cannot use multi session with -stream-media-size Cannot use boot options with -stream-media-size Cannot use Apple hybrid options with -stream-media-size graft_dir: '%s : %s', node: '%s', short_name: '%s' PLEASE CONTACT DISC PUBLISHER FOR SPECIFICATION SOURCE. SEE PUBLISHER IDENTIFIER IN PRIMARY VOLUME DESCRIPTOR FOR CONTACT INFORMATION.THE ROCK RIDGE INTERCHANGE PROTOCOL PROVIDES SUPPORT FOR POSIX FILE SYSTEM SEMANTICSUnable to open pathname list %s. Warning: -C specified without -M: old session data will not be merged. Disabling Rock Ridge / XA / AA Bad Rock Ridge signatures found (SU record missing) Can't have -hfs-boot-file with -apple The option '-H' is reserved by POSIX.1-2001. The option '-H' means 'follow symbolic links on command line'. Mkisofs-2.02 will introduce POSIX semantics for '-H'. Use -map in future to get old mkisofs behavior. Unsupported sector type '%s'. Panic cannot set back effective uid. Unable to open previous session image %s Unable to find previous session PVD %s Unable to open disc image file graft_dir: '%s : %s', node: '%s', (scan) Total extents scheduled to be written = %d Cannot merge previous session. Warning: assuming PC Exchange cluster size of 512 bytes Need either -XA/-xa or -R/-r for -apple to become active. Warning: no Apple/Unix files will be decoded/mapped GRAFT Point:'%s' in '%s : %s' (%s) DNJNfNJNmNQvNNAAUNNQNN"D]N#p]N]N$Q]NQNO&O*ObbQ8OVO^hOBBQsOO,QOOGGQOOOOP-OP8PccQH^IPCCYP`P~Pddh^R P^PDD^PP_PffPPP0_P\_͢P_PP_PPsWPQQQ`'Q P,`.Q QT`:QPFQWQQ`hQ`~Q`QQiiQQQQaQQ4aQQ\a?QJJaQ'aR QaRll,b(R`b>R.bQR.b>RLLbWR`Rc\UmmPiR{RQ0cR XcRcRMMQcRMRcRNNcR!PdR%@dR |dRdRdSooQSSQe2SppM'S;S0eUS/FSJSUSPPFS\e_SeSqSrrezSRReSss#VeSQfSPfS(S|fS)SfSUSSTTfSST TQ*TFTJTcT,gmTmT\gqTUUgT$hThhThT iTQTiTvvTTT|WVVUUUUU+US7UKUSxiXUxxQidUisUiUUUSiUSUUjU*@jU+djUzzj V#VV(VDV4VLVggRV>WhhoVVjHHVjVQkV0kV\kVkVQVVVW~k WQW.Wk9WPBWPWQ^WxWW$lWWWQWWQHlWQ|lWX X*X6XSX]XlhXQlrX|XlX m2YDmXlmXmXXXmXmX nX0nXX YY.YPn9Yn**BAD RRVERSION (%d) for %c%c Unable to locate directory parent call to search_tree_file with an absolute path, stripping initial path separator. Hope this was intended... Fatal error - RR overflow (reclen %d) for file %s Translation table size mismatch %d %d Unable to generate unique name for file %s Fatal goof, file '%s' already in hash table. Directories too deep for '%s' (%d) max is %d. Warning: missing whole name for: '%s' stat parent->whole_name: '%s' -> %d. Unknown file type (%s) %s - ignoring and continuing. Non-existent or inaccessible: %s File %s is too large - ignoring Unable to stat file %s - ignoring and continuing. Symlink %s ignored - continuing. Already cached directory seen (%s) File %s is not readable - ignoring Warning: Directory loop (%s dev: %lx ino: %lu). Directories too deep for '%s' (%d) max is %d; ignored - continuing. To incude the complete directory tree, use Rock Ridge extensions via -R or -r, or allow deep ISO9660 directory nesting via -D. PLCL%4d %5d %s %s000%s%sNEW name '%s' Using %s for %s%s%s (%s) Unable to sort directory %s %c %-*s%sfifochrdirblkregular filesymlinksocketunallocatedHidden from Joliet tree: %s F %s B %s %lu %lu S %s Hidden from ISO9660 tree: %s Hidden ISO9660 attribute: %s D %s ./.rr_movedHidden from HFS tree: %s L %s %s P %s C %s %lu %lu ./rr_movedoctal '%o'Ignoring file %s .bakExcluded by match: %s Path name %s/%s too long. Overflow of stat buffer Unable to open directory %s Scanning %s Excluded: %s Ending PadblockIntermediate PadblockThe File(s)Extension recordDirectory tree cleanupDirectory treeVersion blockEnd Volume DescriptorEnhanced Volume DescriptorPrimary Volume DescriptorInitial PadblockHFS volume header%s_%02dcannot fwrite %d*%d rbcannot read from '%s' cannot open '%s' VIDEO_TSCache hit for '%s%s%s' %d %d %s The pad was %d for file %s Entry %d not in path tables Predicted = %d, written = %d Total directory bytes: %d Path table size(bytes): %d ...ISODEBUGCTCMAX_XTCSIZECTC_LOOPTrying to write %d bytes (not a multiple of 2048). %6.2f%% done, estimate finish %sError: '%s' and '%s' have the same ISO9660 name '%s'. Error: '%s' and '%s' have the same Rock Ridge name '%s'. Directory size too small (. or .. missing ???) Unable to parse DVD-Video structures. Fatal goof - could not find dir entry for '%s' Implementation botch. Video pad for file %s is %d Either the *.IFO file is bad or you found a mkisofs bug. Unexpected directory length %lld expected: %d '%s' Continuation entry record length mismatch %d expected: %d. Fatal ISO9660 goof - directory has amnesia Unable to generate sane path tables - too many directories (%d) Path table lengths do not match %d expected: %d Total extents scheduled to be written (inc HFS) = %d Number of extents written not what was predicted. Please fix. Total translation table size: %d Total rockridge attributes bytes: %d Total extents actually written (inc HFS) = %d (Size of ISO volume = %d, HFS extra = %d) %4.4d%2.2d%2.2d%2.2d%2.2d%2.2d00Unable to make a DVD-Video image. Autostart filename must less than 12 charactersBNon zero-length file '%s' assigned zero extent. Checking name '%s' isorec.name '%s' '%s' does NOT END OK find_hash('%s') Panic: no space, cannot add RR CE entry (%d bytes mising) for %s line %d. currlen: %d ipnt: %d, recstart: %d Send bug report to the maintainer. Negative RR name length residual: %d symbolic link ``%s'' to long for one SL System Use Field, splittingAborting. TFRRPXREPNNMSLSL-path-splitAASL+SL++SL-rootZFSL-currentSL-parentExtension record too long 7SUDF Pad endUDF pad to sector 256UDF pad to sector 32UDF Anchor end volumeUDF file entriesUDF directory treeUDF file setUDF Anchor volumeUDF integ seqUDF second seqUDF main seqUDF volume recognition areaBEA01NSR02TEA01%08X%08XVTS_AUDIO_TSATS_.AOBUnable to locate relocated directory %02XISOREC:XA REC:BAD RR ATTRIBUTES:Disabling RR / XA / AA. SP%c %s Read error on old image %s CD001Should never get here Problems with old ISO directory entry for file: '%s'. Illegal extended directory attributes found (bad XA disk?). Try again using the -no-rr option. Found XA directory extension record. Cannot parse Rock Ridge attributes for '%s'. Warning: Neither Rock Ridge (-R) nor TRANS.TBL (-T) name translations were found on previous session. ISO (8.3) file names have been used instead. Special parameters for cdrecord not specified with -C Malformed cdrecord parameters Previous session has volume set size %d (must be 1). Previous session has incompatible sector size %d. -old-root (sub)directory %s not found in old session. Reading old session failed, cannot execute -old-root. Reading directory %s in old session failed, cannot execute -old-root. Joliet directory treeJoliet path tableJoliet Volume Descriptor%%/%cWarning: Iconv conversion not supported in conv_charset. Incorrectly encoded string (%s) encountered. Possibly creating an invalid Joliet extension. Aborting. Joliet path table lengths do not match %d expected: %d Fatal Joliet goof - directory has amnesia Error: %s and %s have the same Joliet name Unexpected joliet directory length %d expected: %d '%s' Fatal goof - unable to find directory location SccccSccccccccccSScccSccccccccccccccccccccccccccccSexcludedexcluded ISO-9660excluded Joliethidden attribute ISO-9660excluded HFSCan't open sort file list %s Can't open %s file list %s Can't allocate memory for sort filename Incorrect sort file format %sCan't allocate memory for %s filename .tar.gz.tgz.ps.gz.psz||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||Old session has illegal name '%.*s' length %d New session will use name '%s' Eltorito Volume DescriptorEmulating a hard disk No emulation Emulating a 1200 kB floppy No boot image specified. Emulating a 1440 kB floppy Emulating a 2880 kB floppy Uh oh, I cant find the boot catalog directory '%s'! Uh oh, I cant find the boot catalog '%s'! Size of boot image is %d sectors -> Error reading MBR from boot image '%s'. Warning: boot image '%s' MBR is not a boot sector. Warning: partition not marked active. Warning: partition does not start at 0/1/1. Warning: image size does not match geometry (%d) Boot image file '%s' changed underneath us! Boot image '%s' has no partitions. Too many El Torito boot entries Odd alignment at non-end-of-file in boot image '%s'. Boot image '%s' has multiple partitions. Error - boot image '%s' has not an allowable size. Error opening boot image '%s' for read. Uh oh, I cant find the boot image '%s' ! Error opening boot image file '%s' for update. Generic BootSun Disk LabelSun BootToo many boot partitions. Cannot access '%s'. Solaris x86sparcPartition %d may not have a filename. Total extents including %s boot = %d Cannot create sparc boot on offset != 0. CD-ROM Disc with Sun sparc boot created by mkisofsCD-ROM Disc with Sun x86 boot created by mkisofsCannot create generic boot on offset != 0. POSIXLY_CORRECT%s: illegal option -- %c %s: option `%s' is ambiguous %s: unrecognized option `%c%s' %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: option requires an argument -- %c %s: unrecognized option `--%s' %s: option `--%s' doesn't allow an argument Read error on old image Seek error on old image . %s%sCannot open SCSI driver. Cannot get SCSI I/O buffer. test unit readyrezero unitrequest_senseinquiryInquiry Data :read capacitySectorsize: %ld Bytes medium load/unloadprevent/allow medium removalstart/stop unitset streamingscsi_set_streamingset cd speedqic 02write_g0write_g1write_g5seek_g0seek_g1flush cacheread bufferwrite_bufferread subchannelread tocread headerread disk inforead track inforeserve trackreserve_track_rzoneread dvd structuresend opcclose track/sessionread master cuesend_cue_sheetread buffer capBFree: %ld K BSize: %ld K blank unitscsi_format: preparingformat unitscsi_format: running- [unable to fork()]mode sense g1Mode Sense Datamode sense g0Mode Sense Data (converted)SaveSet Mode Parametersmode select g1mode select g0Cannot read TOC header CD-Text len: %d wctbcdtext.datCannot read CD-Text header Cannot read CD-Text Cannot read TOC TOC data: ENT: B0 lout: %ld B0: B0 start: %ld tocheader: Session info too big. Pages: 0x%X Density: 0x%X Blocks: %ld Blocklen:%ld read_g1capacity_not_setread_g0Device type : Version : %d Response Format: %d Vendor_info : '%.8s' Identifikation : '%.16s' Revision : '%.4s' Capabilities : SOFTRESET CMDQUE LINKED SYNC WBUS16 WBUS32 RELADR TERMIOP AENC Device seems to be: Adaptec 4010Kodak PCD-600Sysgen SC4000Matsushita CW-7501Generic mmc2 DVD-R/DVD-RWGeneric mmc CD-ROMMissing Entry for dev %dPioneer DVD-R S101Plasmon RF-4100Emulex MD23Sony CDU-924SGeneric mmc2 DVD-ROMPhilips old CDD-521Ricoh RO-1420CPhilips CDD-2600Sony SMO-C501Adaptec 5500Generic NON CCS DiskAdaptec 4000Adaptec 4070Philips CDD-2000Maxtor RXT800SMatsushita CW-7502unknownBerthold HR-ScannerRicoh RO-1060CAdaptec 4000/4010/4070Generic CCS DiskAdaptec 4520AGeneric mmc CD-RPhilips CDD-521Yamaha CDR-100Emulex MT02Adaptec 4525Emulex MD21Microtek MS300APhilips CDD-522Yamaha CDR-400Pioneer DW-S114XGeneric mmc CD-RWGeneric CD-ROMTeac CD-R50ScaddythisTry to load media by hand. CD capabilitiesInquiry Data : RXT-800SACERCREATIVEGRUNDIGJVCMITSBISHMITSUMIOPTIMAPHILIPSIMSKODAKHPPINNACLEPIONEERPLASMONPLEXTORRICOHSAFSANYOSONYTEACTRAXDATATraxdataT.YUDENWPIYAMAHAMATSHITACDS615EBERTHOLDEMULEXADAPTECCR-4020CCDR2000CDD521/00CDD521/02CDD521CDD522PCD225KHSW/OBCDR-240CDD20CDD26C4324/C4325CD-Writer 6020CDR100IPWXR-W2001XR-W2010R2626CD-R 650ACB-4520ACB-4525RCD-1000RCD5020RCD5040RCD 4X4CD-WO DW-S114XCD-WO DR-R504XDVD-R DVR-S101RF4100CDR4220CD-R PX-R24CSRO1060CCD-R2004CD-R2006 CD-R2006PLUSCD-RW226CD-R4012CD-R CDU92CD-R CDU94CDR4120CD-R55SCD-WO CRD-R24SCD-WO EW-50CDR10CDR200CDR400CDR-632PCD-R CW-7501CD-R CW-7502 %s: %5d kB/s (CD %3ux, DVD %2ux) 162424 (I2S)traypop-upreserved(3)disc changercartridge changerreserved(6)reserved(7)CLV/PCAVreserved(2) Drive capabilities, per MMC page 2A: read CD-R medianot Does %s%s write CD-R mediaread CD-RW mediawrite CD-RW mediaread DVD-ROM mediaread DVD-R mediawrite DVD-R mediaread DVD-RAM mediawrite DVD-RAM mediasupport test writingread Mode 2 Form 1 blocksread Mode 2 Form 2 blocksread digital audio blocksread multi-session CDsread CD bar coderead R-W subcode informationreturn CD ISRC informationsupport C2 error pointersdeliver composite A/V dataplay audio CDsLoading mechanism type %s: %s Is %s%s support changing side of diskMaximum read speedCurrent read speedMaximum write speedCurrent write speedBuffer size in KB %s: %d Write speed # %d: MMC-2send digital data LSB-firstLength of data in BCLKsRotational control selected MMC-3Capacity: %ld Blocks = %ld kBytes = %ld MBytes = %ld prMB scsi_format: post processing %d Formating in progress: 0.00 %% done. Formating in progress: %.2f %% done [%d]. Formating in progress: 100.00 %% done. Mode Parameters (un-converted)Cannot load media with %s drive! error: %d scb.chk: %d sense_count: %d sense.code: 0x%x restart non-streamed digital audio reads accuratelysupport Buffer-Underrun-Free recordingread fixed-packet CD media using Method 2return R-W subcode de-interleaved and error-correctedread raw P-W subcode data from lead inreturn CD media catalog numbersupport ejection of CD via START/STOP commandlock media on power up via prevent jumperallow media to be locked in the drive via PREVENT/ALLOW commandcurrently in a media-locked statehave load-empty-slot-in-changer featuresupport Individual Disk Present feature Number of supported write speeds: %d Number of volume control levelssupport individual volume control setting for each channelsupport independent mute setting for each channelsupport digital output on port 1support digital output on port 2set LRCK high for left-channel datahave valid data on falling edge of clockCopy management revision supported:zD7Mb?/^]6]]YY] ATIP start of lead out: %ld (%02d:%02d/%02d) ATIP start of lead in: %ld (%02d:%02d/%02d) Mode Page DataCannot get default %s data. Cannot get %s mask. Cannot get %s data. Cannot get saved %s data. Mode Select DataWarning: controller returns wrong page %X for %s page (%X). Warning: controller creates hard SCSI failure when retrieving %s page. Warning: controller does not support %s page. Warning: controller returns zero sized %s page. Warning: controller returns wrong size for %s page. Warning: using default %s data. None.finderinfo/.resource/CAP.AppleDouble/Netatalk%.rsrc/EtherShare/UShareFINDER.DATRESOURCE.FRK/Exchangefinder.datresource.frk/.HSancillary.HSResource/XINET/SGIMacBinaryAppleSingleDAVE:Afp_AfpInfo:Afp_ResourceSFM._MacOS X AppleDouble/rsrcMacOS X HFS .finderinfo.resource.ADeskTop.IDeskTopNetwork Trash Folder.rootinfo.rsrc.Desktop.DeskServer.Label.AppleDouble.AppleDesktopRESOURCE.FRKDESKTOPFILEID.DATresource.frkfileid.dat.HSResourceDesktopFolderDB:Comments%RootInfo File type: %s HFS Name: %s ISO Name: %s CREATOR: %s TYPE: %s %4s%4s unable to open magic file%1snot enough memoryunable to open mapping filewarning: %s doesn't appear to be a %s file %s%*s%*1s%c%c%c%c%*1s%*1s%c%c%c%c%*1serror scanning afpfile %s - continuingTYPE_SGL error - shouldn't happen!TYPE_MBIN error - shouldn't happen!TYPE_ESH error - shouldn't happen!TYPE_DBL error - shouldn't happen!P0PPPPQ֮5XȯIcon%s %s%dUsing HFS name: %s for %s HFS scanning %s can't HFS close file %scan't HFS create file %scan't HFS create folder %scan't HFS set attributes %scan't HFS open %sBlessing %s (%s) Creating HFS Volume info can't HFS mount %scan't HFS format %scan't locate relocated directory %scan't find directory location %sDesktop DBDesktop DFPReP boot partition %d is "%s" Creating %d PReP boot partition(s) Uh oh, I cant find the boot image "%s"! unable to read HFS boot file %sunable to stat HFS boot file %sunable to open HFS boot file %sunable to read HFS boot block %s%s does not contain a valid boot blockunable to seek HFS boot file %sCHRP boot partition 1 Apple_HFSwith boot fileCreating HFS Label %s %s %s is not a HFS boot fileApple_DriverStream File Path tableStream File DirectoryStream File%s/VIDEO_TS/VTS_%02d_0.IFODVDVIDEO-VMGDVDVIDEO-VTS%s/VIDEO_TS/VIDEO_TS.IFOFaild to read VIDEO_TS.IFO Faild to seek VIDEO_TS.IFO Faild to open %s Giving up this is not a valid IFO file %s/VIDEO_TS/VIDEO_TS.VOB%s/VIDEO_TS/VTS_%02i_0.IFO%s/VIDEO_TS/VTS_%02i_0.VOB%s/VIDEO_TS/VTS_%02i_%i.VOBcalc: Can't stat %s Can't open device '%s' Can't open VTS info. Either VIDEO_TS.IFO or VIDEO_TS.VOB is not of correct size. %s/VIDEO_TS/VTS_%02i_0.IFO appears to be corrupted. Either VIDEO_TS.IFO or VIDEO_TS.VOB is not of correct sizeCan't open VMG info for '%s'. IFO is not of correct size aborting IFO is not of correct size aborting. %s/%s/VIDEO_TS/VIDEO_TS.BUP/VIDEO_TS/VTS_%02i_0.BUPCould not open %s Invalid domain for file open. /etc/cdrecord.conf,:/@%s=CDR_DEVICECDR_DEVICE=CDR_FIFOSIZEBad fifo size environment. CDR_SPEEDBad speed environment. CDR_SPEED=CDR_FIFOSIZE=Bad fifo size in defaults. Value %lld is too large for data type 'long'. not a Macintosh HFS volumevolume size must be >= 800Kno more entriescan't move across volumescan't use destination namebad destination pathcan't move root directorybad volume allocation block sizevolume name may not contain colonsvolume name must be 1-27 charsunexpected directory entry foundcan't move directory inside itselfcan't move above root directoryno errorshould not happen!read unallocated blockread nonexistent blockwrite unallocated blockwrite nonexistent blockbad partition mapcan't find HFS partitionunsupported block sizeunsupported partition map signatureunsupported start of partition logical datavolume bitmap collides with volume dataPossible Catalog file overflow - please report errorfile extents exceed file physical lengthfile extents exceed physical sizefile size exceeds physical lengthempty file extentread nonexistent b*-tree nodetoo many b*-tree node recordsread unallocated b*-tree nodemalformed b*-tree header nodeunsupported b*-tree node sizemalformed b*-tree map nodetruncated b*-tree mapunexpected b*-tree nodeb*-tree record already existsb*-tree record not foundempty b*-treewrite nonexistent b*-tree nodewrite unallocated b*-tree nodeb*-tree fullfree b*-tree node not foundbad thread recordvolume fullempty pathinvalid pathnameunexpected catalog recordno volume is currentcan't find parent directorybad volume bitmap or free block countQXNQOOONOONOOcont offset type opcode mask value desc~~~~ތ~~~h~~~~~~ތғ{bytestringbeshortlibfile: Out of memory. belongbedateString too long: %s leshortlelongledate%.3oHggHgLgngԕrԕ<rrBOINKcp437cp737cp775cp850cp852cp855cp857cp860cp861cp862cp863cp864cp865cp866cp869cp874cp1250cp1251iso8859-2iso8859-3iso8859-4iso8859-5iso8859-6iso8859-7iso8859-8iso8859-9iso8859-14iso8859-15koi8-rkoi8-ucp10006cp10007cp10029cp10079cp10081%x%xUCS-2BEREMOTE:rscsi@host:1,2,0rscsi@host:bus,target,lunREMOTE:Remote SCSIRSCSIProtocol error (got %s). Remote status(%s): %d '%s'. R%d A isatapiI initiator idT%d %d %d %d filenoB%d %d havebusF freebufM%ld getbufsndsize: %d rcvsize: %d D%ld maxdmacloseV%d S%d %d %d %d %d sendcmdREMOTE%.*sRSHdup2 failed. Illegal remote device syntaxO%s opentcpshellCannot create socketpair. /opt/schily/sbin/rscsiUnknown user: %s rshshell/tcp: unknown service setuid(%lld) failed. seteuid(%lld) failed. -lexeclp '%s' failed. Lost connection to remote host ?? locuser: '%s' rscsiuser: '%s' host: '%s' Warning: Using remote SCSI interface. Illegal value for busno, target or lun '%d,%d,%d'who are you? No passwd entry found. Cannot get connection to remote hostrcmdsh: fork to lose parent failed. {tm'''''''[I7yesYESstatus: 0x%x Reserved(%s%s) host adapter detected errorBUSYINTERMEDIATE GOOD STATUSRESERVATION CONFLICTCHECK CONDITIONCONDITION MET/GOODSense Bytes:Write Data: CDB: retryable errorfatal errorerror: %d%s: scsi sendcmd: %s Received Data: resid: %d DMA overrun, vendor specific %d unknown device type 0x%xRemovable not present unsupported reserved unsupported TapeWORMProcessorPrinterunit not presentWell known lunAutomation/Drive InterfaceObject based storageBridging expanderOptical card r/wSimple direct accessEnclosure servicesStorage arrayIT8 2IT8 1CommunicationJuke BoxOptical Storageunknown/no deviceSCSI ALREADY RUNNING !!INTERMEDIATE CONDITION MET/GOODSending %d (0x%X) bytes of data. SCSI command name not set by callercmd timeout after %ld.%03ld (%d) s Executing '%s' command on Bus %d Target %d, Lun %d timeout %ds Got %d (0x%X), expecting %d (0x%X) bytes of data. cmd finished after %ld.%03lds timeout %ds Cannot send SCSI cmd via ioctl ret < 0 errno: %d ux_errno: %d error: %d Currently running '%s' command. ƻлڻzm`SF9, scgo_send(%s) wrote %d bytes (expected %d). DMA (read) overrun by %d bytes (requested %d bytes). ATA Packet specific SCSI transportEXAMPLE: /dev/scsi/host1/bus2/target3/lun4/cd EXAMPLE: /dev/ide/host0/bus0/target1/lun0/cd EXAMPLE: /dev/hda or /dev/sr0 ERROR: in scgo_get_first_free_shillybus(...). Too many CDROMs, more than %iIncrease MAX_SCHILLY_HOSTS in scsi-linux-ata.c and recompile!ERROR: unknow subsystem (%s) in (%s) ERROR: this cdrom is already mapped %s(%d,%d,%d) INFO: subsystem %s: h %i, b %i, t %i, l %iERROR: with link merging! base %s link %s, result of merging %i ERROR: with link reading! link %s, result of readlink %i INFO: /dev/%s, (host%d/bus%d/target%d/lun%d) will be mapped on the schilly bus No %d (%d,%d,%d) INFO: Bus: %d Target: %d Lun: %d Chan: %d Ino: %d try open(%s) return %i errno %i calling sg_mapdev(...) Warning: Using ATA Packet interface. Warning: The related Linux kernel interface code seems to be unmaintained. Warning: There is absolutely NO DMA, operations thus are slow. errno (EACCESS), you don't have the needed rights for %s try open(%s) return %i, errno %i, trying next cdrom Illegal value for bus, target or lun '%d,%d,%d'try open(%s) return %i, errno %i, cancel INFO: scan_internal(...) failedNOT IMPELEMENTED: scgo_initiator_idioctl(CDROM_SEND_PACKET) ret: %d Generic transport independent SCSISCSI transport for ATAPI over Parallel PortATA Packet specific SCSI transport using sg interfaceBus: %d Target: %d Lun: %d Chan: %d Ino: %d Target (%d,%d,%d): DMA max %d old max: %ld Warning Linux Bus mapping botch. SCSI Bus: %d (mapped from %d) Linux sg driver version: %d.%d.%d Use of ATA is preferred over ATAPI. SCSI unsupported with '/dev/hd*'DMA addr: 0x%8.8lX size: %d - using copy buffer pack_len: %d, reply_len: %d pack_id: %d result: %d sense[0]: %02X Allocated DMA copy buffer, addr: 0x%8.8lX size: %ld host_status: %02X driver_status: %02X No remote SCSI transport available. Can't do %d byte command. ATAPI:1,2,0ATAPI:ERROR: unknow format INFO: %s -> %s srINFO: l1: 0x%lX l2: 0x%lX ATAPI/dev/cdroms/cdrom*/dev/hd[a-z]INFO: do scgo_open openbydevCannot open '%s'schily - Red Hat%d.%d.%dsgpgATA:scgo_getbuf: %ld bytes Cannot set SG_SET_TIMEOUT. Bus: %d cookie: %X file (%d,%d,%d): %d /dev/hd/dev/scd[0-9]/dev/scd[0-9][0-9]Cannot open '/dev/scd*'PP Bus: %d /dev/pg%dCannot open '/dev/hd*'/dev/pg[0-9]/dev/pg[0-9][0-9]Cannot open '/dev/pg*'ioctl ret: %d None.SCSI open usage error. Supported SCSI transports for this platform:WARNING: device not valid, trying to use default target... scsibus: %d target: %d lun: %d Invalid value for bus, target or lun (%d,%d,%d)Invalid bus or target specifier in '%s'Invalid target or lun specifier in '%s'scg__open(%s) %d,%d,%d HELPscsidev: '%s' devname: '%s' No memory for SCSI structureInvalid lun specifier '%s'Invalid lun specifier in '%s'No Additional SenseRecovered ErrorNot ReadyMedium ErrorHardware ErrorIllegal RequestUnit AttentionData ProtectBlank CheckVendor UniqueCopy AbortedAborted CommandEqualVolume OverflowMiscompareno write currentexcessive write errorsunreachable copy target tracking servo failure focus servo failure spindle servo failure head select fault block not compressible third party device failureread retries exhaustederror too long to correctmultiple read errorsl-ec uncorrectable errorcirc unrecovered errorincomplete block read no gap found miscorrected error de-compression crc errorerror reading isrc numberrecord not foundend-of-data not foundblock sequence errorrecovered data with retriesrecovered data with circrecovered data with l-ecrecovered data with linkingdefect list not availablegrown defect list not found!invalid element address!invalid address for write$cdb decryption error&parameter not supported&parameter value invalid&data decryption error&too many target descriptors& unexpected inexact segment& inline data length exceeded'hardware write protected'associated write protect'persistent write protect'permanent write protect'conditional write protect)power on occurred)scsi bus reset occurred)device internal reset*mode parameters changed*log parameters changed*reservations preempted*reservations released*registrations preempted,too many windows specified,persistent prevent conflict0cleaning failure0medium not formatted1format command failed2defect list update failure8esn - media class event;slew failure;paper jam;failed to sense top-of-form;reposition error; read past end of medium; position past end of medium;medium source element empty;end of medium reached;medium magazine removed;medium magazine inserted;medium magazine locked;medium magazine unlocked>logical unit failure>timeout on logical unit?microcode has been changed?inquiry data has changed?component device attached?device identifier changed?redundancy group deleted?spare created or modified? spare deleted? volume set deleted? volume set deassigned? volume set reassigned?echo buffer overwritten?medium loadablePwrite append position errorSunload tape failureSmedium removal preventedUsystem buffer fullUinsufficient resources[threshold condition met[log counter at maximum[log list codes exhausted\spindles synchronized\spindles not synchronized^Bpower state change to idle^Epower state change to sleepaunable to acquire videoaout of focusdinvalid packet sizegadd logical unit failedgassign failure occurrediparity/data mismatchkredundancy level got betterkredundancy level got worsesprogram memory area is fullsrma/pma is almost fullinvalid sense code 0x%Xvendor unique sense code 0x%X[]no sense, deferred error [No matching qualifier](illegal block length end of medium file mark detected (valid) (not valid) Sense flags: Blk %d %s%s%s%sinvalid sensekeyactual retry count %doperation %d%% done(valid)command(not valid) disk not inserted load/unload failure spindle failure focus failuretracking failurebias magnet failure#illegal function for medium type8recoverable write error9write error recovery failed:defect list update failed=defect list not availablelimited laser lifelaser focus coil over-currentlaser tracking coil over-currenttemperature alarmECC error during verifyinterleave errorbad format on driveself test faileddefective track#volume overflow+set limit violation,error counter overflow-initiator detected error.scsi parity error/adapter parity errorno additional sense informationfilemark detectedend-of-partition/medium detectedsetmark detectedbeginning-of-partition/medium detectedend-of-data detectedi/o process terminatedaudio play operation in progressaudio play operation pausedaudio play operation successfully completedaudio play operation stopped due to errorno current audio status to returnoperation in progresscleaning requestedno index/sector signalno seek completeperipheral device write faultlogical unit not ready, cause not reportablelogical unit does not respond to selectionno reference position foundmultiple peripheral devices selectedlogical unit communication failure track following error error log overflow warning write error error detected by third party temporary initiatorid crc or ecc errorunrecovered read erroraddress mark not found for id fieldaddress mark not found for data fieldrecorded entity not foundrandom positioning errordata synchronization mark errorrecovered data with no error correction appliedrecovered data with error correction applieddefect list errorparameter list length errorsynchronous data transfer errordefect list not foundmiscompare during verify operationrecovered id with ecc correctionpartial defect list transfer invalid command operation code!logical block address out of range"illegal function (use 20 00, 24 00, or 26 00)$invalid field in cdb%logical unit not supported&invalid field in parameter list'write protected(not ready to ready change, medium may have changed)power on, reset, or bus device reset occurred*parameters changed+copy cannot execute since host cannot disconnect,command sequence error-overwrite error on update in place.insufficient time for operation/commands cleared by another initiator0incompatible medium installed1medium format corrupted2no defect spare location available3tape length error4enclosure failure5enclosure services failure6ribbon, ink, or toner failure7rounded parameter8event status notification9saving parameters not supported:medium not present;sequential positioning error=invalid bits in identify message>logical unit has not self-configured yet?target operating conditions have changed@ram failure (should use 40 nn)@diagnostic failure on component nn (80h-ffh)Adata path failure (should use 40 nn)Bpower-on or self-test failure (should use 40 nn)Cmessage errorDinternal target failureEselect or reselect failureFunsuccessful soft resetGscsi parity errorHinitiator detected error message receivedIinvalid message errorJcommand phase errorKdata phase errorLlogical unit failed self-configurationMtagged overlapped commands (nn = queue tag)Noverlapped commands attemptedPwrite append errorQerase failureRcartridge faultSmedia load or eject failedTscsi to host system interface failureUsystem resource failureWunable to recover table-of-contentsXgeneration does not existYupdated block readZoperator request or state change input[log exception\rpl status change]failure prediction threshold exceeded^low power condition on`lamp failureavideo acquisition errorbscan head positioning errorcend of user area encountered on this trackdillegal mode for this trackevoltage faultfautomatic document feeder cover upgconfiguration failurehlogical unit not configuredidata loss on logical unitjinformational, refer to logkstate change has occurredlrebuild failure occurredmrecalculate failure occurredncommand to logical unit failedocopy protection key exchange failure - authentication failurepdecompression exception short algorithm id of nnqdecompression exception long algorithm idrsession fixation errorscd control error%logical unit is in process of becoming readylogical unit not ready, initializing cmd. requiredlogical unit not ready, manual intervention requiredlogical unit not ready, format in progresslogical unit not ready, rebuild in progresslogical unit not ready, recalculation in progresslogical unit not ready, operation in progresslogical unit not ready, long write in progress logical unit not ready, self-test in progress asymmetric access code 3 (00-232) [proposed] asymmetric access code 1 (00-232) [proposed] asymmetric access code 2 (00-232) [proposed]auxiliary memory code 2 (99-148) [proposed]logical unit communication time-outlogical unit communication parity errorlogical unit communication crc error (ultra-dma/32) warning - specified temperature exceeded warning - enclosure degraded write error - recovered with auto reallocation write error - auto reallocation failed write error - recommend reassignment compression check miscompare error data expansion occurred during compression write error - recovery needed write error - recovery failed write error - loss of streaming write error - padding blocks added auxiliary memory code 4 (99-148) [proposed] copy target device not reachable incorrect copy target device type copy target device data underrun copy target device data overrununrecovered read error - auto reallocate faileddata re-synchronization error unrecovered read error - recommend reassignment unrecovered read error - recommend rewrite the datacannot decompress using declared algorithmerror reading upc/ean numberread error - loss of streamingauxiliary memory code 3 (99-148) [proposed]filemark or setmark not foundrecord not found - recommend reassignmentrecord not found - data auto-reallocatedmechanical positioning errorpositioning error detected by read of mediumdata sync error - data rewrittendata sync error - recommend rewritedata sync error - data auto-reallocateddata sync error - recommend reassignmentrecovered data with positive head offsetrecovered data with negative head offsetrecovered data with retries and/or circ appliedrecovered data using previous sector idrecovered data without ecc - data auto-reallocatedrecovered data without ecc - recommend reassignmentrecovered data without ecc - recommend rewrite recovered data without ecc - data rewrittenrecovered data with error corr. & retries appliedrecovered data - data auto-reallocatedrecovered data - recommend reassignmentrecovered data - recommend rewriterecovered data with ecc - data rewrittendefect list error in primary listdefect list error in grown listprimary defect list not found access controls code 1 (99-314) [proposed] access controls code 2 (99-314) [proposed] access controls code 3 (99-314) [proposed] read type operation while in write capable state write type operation while in read capable state illegal command while in explicit address model illegal command while in implicit address model access controls code 5 (99-245) [proposed] access controls code 6 (99-245) [proposed] access controls code 7 (99-245) [proposed] access controls code 8 (99-245) [proposed]$invalid cdb field while in explicit block address model$invalid cdb field while in implicit block address model&threshold parameters not supported&invalid release of persistent reservation&unsupported target descriptor type code&too many segment descriptors& unsupported segment descriptor type code& invalid operation for copy source or destination& copy segment granularity violation'logical unit software write protected(import or export element accessed)bus device reset function occurred)transceiver mode changed to single-ended)transceiver mode changed to lvd*asymmetric access code 6 (00-232) [proposed]*asymmetric access code 7 (00-232) [proposed],invalid combination of windows specified,current program area is not empty,current program area is empty,illegal power condition request0cannot read medium - unknown format0cannot read medium - incompatible format0cleaning cartridge installed0cannot write medium - unknown format0cannot write medium - incompatible format0cannot format medium - incompatible medium0cannot write - application code mismatch0 current session not fixated for append1zoned formatting failed due to spare linking5unsupported enclosure function5enclosure services unavailable5enclosure services transfer failure5enclosure services transfer refused8esn - power management class event8esn - device busy class event:medium not present - tray closed:medium not present - tray open:medium not present - loadable:medium not present - medium auxiliary memory accessible;tape position error at beginning-of-medium;tape position error at end-of-medium;tape or electronic vertical forms unit not ready;failed to sense bottom-of-form; read past beginning of medium; position past beginning of medium; medium destination element full;medium magazine not accessible;mechanical positioning or changer error>logical unit failed self-test>logical unit unable to update self-test log?changed operating definition?redundancy group created or modified? volume set created or modified?reported luns data has changed?medium auxiliary memory accessibleGdata phase crc error detectedGscsi parity error detected during st data phaseGinformation unit crc error detectedGasynchronous information protection error detectedPposition error related to timingQerase failure - incomplete erase operation detectedUinsufficient reservation resourcesUinsufficient registration resourcesUaccess controls code 4 (99-314) [proposed]Uauxiliary memory code 1 (99-148) [proposed]Zoperator medium removal requestZoperator selected write protectZoperator selected write permit]media failure prediction threshold exceeded]logical unit failure prediction threshold exceeded]spare area exhaustion prediction threshold exceeded]hardware impending failure general hard drive failure]hardware impending failure drive error rate too high]hardware impending failure data error rate too high]hardware impending failure seek error rate too high]hardware impending failure too many block reassigns]hardware impending failure access times too high]hardware impending failure start unit times too high]hardware impending failure channel parametrics]hardware impending failure controller detected]hardware impending failure throughput performance]hardware impending failure seek time performance]hardware impending failure spin-up retry count]hardware impending failure drive calibration retry count] controller impending failure general hard drive failure]!controller impending failure drive error rate too high]"controller impending failure data error rate too high]#controller impending failure seek error rate too high]$controller impending failure too many block reassigns]%controller impending failure access times too high]&controller impending failure start unit times too high]'controller impending failure channel parametrics](controller impending failure controller detected])controller impending failure throughput performance]*controller impending failure seek time performance]+controller impending failure spin-up retry count],controller impending failure drive calibration retry count]0data channel impending failure general hard drive failure]1data channel impending failure drive error rate too high]2data channel impending failure data error rate too high]3data channel impending failure seek error rate too high]4data channel impending failure too many block reassigns]5data channel impending failure access times too high]6data channel impending failure start unit times too high]7data channel impending failure channel parametrics]8data channel impending failure controller detected]9data channel impending failure throughput performance]:data channel impending failure seek time performance];data channel impending failure spin-up retry count]F>;;;;>;;F>;c?;;;;;;;;;;;;;;;;;;;;;?;;;;;;;?B<<<<0B<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< @<<<< @<<<<< @<<@@<<<<<bB< @<<<<<<<EBlB @AAiA]A @QA<@<@ @q@<@@1A<@<<GA< @; h<\|zR| $PAB E<T AB E\@AB E$  Mh Q W ȓ ohooZ,W Ηޗ.>N^n~Θޘ.>N^n~Ιޙ.>N^n~Κޚ.>N^n~Λޛ.>N^n~Μޜ.>N^n~Νޝ.>N^n~Ξ$W M M MZ M M M M MZ MZ MhZ MdZ  NNN!N+N8N>N\m@mkisofs 2.01.mkisofsrc&UbWTV8XBU_T^U:U1VšUVٚT?STPT>OTN T0bG'TEVA`RhG J1./؀wDZ#ok~Tw ffՎǣ{$ϧ T;@CEɪTR R  ȱ?AyʿܿYY,}#+#+t@$ ߚ|%YY%/ YY19 #+E JWe ii#+l ,AFP8  "#()*+,/0123456789:;<=>?@ABCDEFGHXZ^`gikmsuwy{THXZ^`gikmsuwy{LP\b}UJVLNP\bdefopqr}RWR&' JN$%-.ا<Zc a   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~g   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~bj h pu  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %t s r q p o n ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠhw u   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%e"d"H""" % ~ } | { ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~n    !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~#BVW+yM"Z[*{|z A%%%%$% c%Q%W%]%.`%%4%,%%%<%rjZ%T%i%f%`%P%l%} /ask~% %%%%%%LCD67;<FE   "%     ͺްЀӷ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~噞t  К՚  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%%%%$%c%Q%W%]%%%4%,%%%<%Z%T%i%f%`%P%l%1% %%%% %    ͺ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Ͼ󨷵ǎԐѥ噞ᅠƄФz@ @   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~oBPQy9:=>Z[deA }~z _%%%%$%^c%Q%W%]%{|%%4%,%%%<%Z%T%i%f%`%P%l%G% %%%bn%CDH`aTUpcqXY%@ @ @ @ ͺǤޅ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~` `   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~RSQTUVWXY Z [ \ ^_N.J*01F&45D$3%%%%$%E%8c%Q%W%]%9%%4%,%%%<%:Z%T%i%f%`%P%l%;<=>?% %%%O%/@ A!B"C#62L,!K+7H(M-I)G'%` ` ` ` ͺ쭧諶ࠢ묦窵  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  05  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~10^_%%%%$%c%Q%W%]%%%4%,%%%<%Z%T%i%f%`%P%l%% %%%%%   ͺ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ϾѮЯ󨷵ǎԐᅠƄ졌  PU  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ %%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %      ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠ  pu  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %       ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠ    !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %        ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~    !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %       ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  Л՛  !"#$j&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~""%%%<%$%,%%4%% %%%"H" `abcdefghi@}Q%      ¢åǨ%  !"#$&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ܡ@ @   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %@ @ @ @ @ @ @ ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠ` `   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%@ABCDEFGHIJKLMNOQTW^""!%` ` ` ` ` ͺɸȾ̵ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  05  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   %%%%$%c%Q%W%]%%%4%,%%%<%Z%T%i%f%`%P%l%% %%%%%    ͺՑ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  PU  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~&     "         !"#$%&'()*+,-./0123456789:?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[     !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!  pu  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   & ! 0 `9 Zd}y    "   "!a: [e~zA^{B_=>|T9 CGPXnpbU: DHQYoqc) ( ' & % 㥹  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~, *   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ S & ! 0 9   R    "   "!Y: Z\[_^VQ!TXUW !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNO3 2 1 0   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Z7 5   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~;   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ >  < М՜  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~A=Z`^dy}{B>[a_ez~|T9 CGPXnpbU: DHQYoqc D  C  B 㡱  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@G @E   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~&$0^4{'%1_5|  l\  !m]@M @L @K   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~`P `N   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~8V(;`"f}W)<a#gJ~K. *EL6rhj/ +FM7sik`V `U `T   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Y W 05  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNO!QRSTUVWXYZ[\^__ ^ ]   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~b ` PU  !"#$%&'()*+,-./`abcdefghi:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:@ABCDEFGHIJKLMNOPQRg f 0123456789  !"#$%&'()*+,-./:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~j h pu  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ q p o n   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ t r   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~>  z y x   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~~ |   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~0^1_    !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   Н՝  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~    x !@AVW`atjvukw     !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~+@ @   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ `a}~RSx@ @ @   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~6` `   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%% %%%%%$%,%4%<%%%%%%%%% #%""H"d"e"!#P%Q%R%QS%T%U%V%W%X%Y%Z%[%\%]%^%_%`%a%b%c%d%e%f%g%h%i%j%k%l%N01F45D3E89:;<=>?O@ABC62LK7HMIGJ.&$%/ !"#,+(-)'*` ` ` ` `   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~=  05  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%% %%%%%$%,%4%<%%%%%%%%% #%""H"d"e"!#P%Q%R%QTT%VWW%X%Y%Z%[%]%^%_%`%a%c%f%g%h%i%j%l%N01F45D3E89:;<=>?O@ABC62LK7HMIGJ.&$%/ !"#,+(-)'*       !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~[  PU  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ " "!`""d"e""""+""H""& RS      %xD 9 : !   0 1            !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ֿ̀ͅD  pu !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~"!" 0 `"d"e"H"& S             æ˼̾ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~œL   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./ " "!R`"S"d"e"VTW Y ZX"H""& [ \U       ^_!QO0123456789:;<=>?@ABCDEFGHIJKLMN      ݫڀެϴ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~T   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  yz " "!`"#./*d"e"+6""B;<=>9:EFC"DG"& HPQL      %MTUX9 : YVW`  aZ[de}~jknopqrs7{A|"       Ŀ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͅ\  О՞ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~" "!`""d"e""""+""H""& RS      %xD   0 1          !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~̀܄ͅާݖֿd@ @  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ " "!`""d"e""""+""H""& RS      %x01^_!   0 @ @ @ @ @ @ @ @ @  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ֿ̀ͅ ڢZ68@(#)scsi-remote.c 1.16 04/08/24 Copyright 1990,2000-2003 J. Schillingschilyremote-1.16@(#)scsitransp.c 1.91 04/06/17 Copyright 1988,1995,2000-2004 J. Schillingschily0.8    $ < Q f k r |       $ < Q f k r |    QT=G.VTP@(#)scsi-linux-ata.c 1.7 04/06/12 Copyright 2002 J. Schillingschilyscsi-linux-ata.c-1.7@(#)scsi-linux-sg.c 1.83 04/05/20 Copyright 1997 J. Schillingscsi-linux-sg.c-1.83-RH@(#)scsi-linux-pg.c 1.43 04/01/15 Copyright 1997 J. Schillingscsi-linux-pg.c-1.43@(#)scsihack.c 1.43 03/11/28 Copyright 1997,2000,2001 J. Schillingscsihack.c-1.43'6CO]jz (<Rdt 3 H h         / H c w      ) @ \       8 M f |   D |    H x     < l    @    e (}  ( T  t    $ <T t     U 4 X |   r    ( .`  I   8 ` e x$ P | |      D  p    ( `     0 \      3 T v $ 5    D t    < p    4   SmH x d      0 \ |  '   E `{ ,  P x  H ,E^v  `  (! T! x! !     ! ! " 0" X" " " " @  # \     <# `# # #    # *#  : $ @$ d$ $ P $ $ % DS_L% }p% % % % 3L% p  g~(& H&  x& & #?& Od|& '   @ h      0' P' ' '  < T j     '  ( ! 3 P x @( $h( ( (     ( ) 8)  =Wp% < \) ) ) ) 4* l* * * + H+ + + + , P, , , , 8- p- - - . T. . . . ,/ `/ / / 0 T0 0 0 1 @1 x1 1 1  2 X2 2 2 3 83 l3 3 3 4 44 d4 4 4 4 05 h5 5 5 6 H6 |6 6 6 7 H7 |7 7 7  8 X8 8 8 9 49 l9 9 9 : <: p: : d : ; (; P; |; ; ; }    ;  #   < 4< `< E < 9< < = 4= X= S|= = = ] { > m      0 $> `> > > ? p   L? x? ? ? @  0@ X@ |@ @ file_write_err]  ?bad_file_opbad_file_modebad_fileYB  tC C \wC YB {C C ~C C 0123456789abcdef0123456789ABCDEF(Infinity)(NaN)mkisofs.debugpΒ.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.gnu_debuglink 44HH !hh0' p/Q7oZZDohh`S ȓ \  e`@kĮqMwM xF x$F |W  W  (W (,W ,W W Y   }$$D$D$E D$ ,D$EU D$E$Et.t >$D$*D$E $D$ ,D$DžtI E |$$of$LD$*D$E D$ ,D$$I%$ D$*D$E $D$ ,D$WDžtI$]$\$D$ƋE$u4$E D$&4$EU$EEUD$ ED$E D$.E D$E$E<$"D$*D$E $D$ ,D$nDžtI$\$D$E D$ D$ ,D$$$IL$D$0D$ED$ ,D$$B p$Vt$D$E D$PD$ ,D$u<$"D$tD$ED$ ,D$UWVS1ۉDžp}с $EED$E$ED$$E/x} ؉1с $EE D$E$xED$$/Dž|tEtS}؉с $2|ED$|$|D$$/E$D$ED$;E$jE D$$4$kX @ ƒ.uStڃ.u C.uCtċx\$$Ut\$$Ct \$<$3ED$ |D$ED$E$Vp_4$E$OE$DpĬ[^_]$D$D$ED$ ,D$$B$vD$D$E $D$ ,D$IvO$5D$D$ED$ ,D$|USE$~"44E<tÃu ąu#[]a\$$$F$U4t4uUu$^49H49~44 t1҅u0á44U0uËE$OUE$tá,$$GUE$tá,$X$GUU;EsÉT$E D$ $ÐUWVS,uFXV\EUEVEEUUUD${ D$ $T$ <@t2G\W`M13E uGWM13E uF9Gt?u1,[^_]ËF9GuF9GuF9G u؋F,V0_413G0 uƋFH9GLuGdUWV@SMQAXQ\D${ D$ $T$S $haËUCT$D$`$E $eCd[^_]ÐUE UB]UU]RUU MЈQ]UU]RUE UBBB]UE UBBB]UM]QQQUE UBBB]UM]QQQUE UBJJJJBB]ÐUVSMb M A@EqD)‰UAHEIL)ED$EU$& [^]ÐUWV}S]؁\1 EEءUE܍ET$$EE D$D$D$ $IUI։F$D$T$$AU D$D$$4qDžUD$T$ D$$@w;1t u Dž$T$;1 = t=tvDžD$\$ D$T$$SuEU D$D$T$ $(;F>uG$ځ\[^_]ËT$$NU D$D$$jt/E D$D$ T$$~;t4I$rJ$X$E9u1%U$TE $IDž+U \$T$ D$$9u`UD$T$ D$$uU $E $aT$$_1~ItUWVuS\E]D$D$ D$4$Et=9úJu*U \$D$T$ 4$;EPI\[^_]ÿ D$ED$M $pJ.tEJ$=EEEEeEE$U$EЋME\M$EȋE\$D$ D$Uȉ$9؉EvMȋEMącEĉ$EUĉÉ$);uD$\$M $}Et$D$D$ <$9UEԉUԉt$ |$D$MЉ $E9EE;EL9Et&$t&sNjE؉E܉GEGEG EM L$ ED$<$D$;EED$D$D$ <$IEu<$ZU$_҃J1Uȉ$3<$+MЉ $ \[^_]ËE;Erg;EvUUԉЋM D$D$L$ EЉ$A;EuN)E+MD$L$EЉ$UUIA]EԾJPIFG9MɉUtE܉EEEUMHEU0^_É;}vUM̉UMEUEU0^_ǃEua9}w9urŰE)E܉ŰUtE܋ỦEUMEUQ녅u 1ƋẺE܉U= +EԉE؉MMM׊M؋U E̊ME̊M؋E ẺE̊MUe;ỦEw uE9Ev M)MȋEM̋E+EщM̉ʊMMԉE ‹EUEUWVS [BZE)19s׉M)F9Ήr [^_ÉUWVS[) pNu. [^_ÐUSR vЋuX[US[ËPY[forceleveluncompressparallelismstrict-one-filesystemcrib-treestrict-localfileverbosequietverbosityhelpversionfz:up:xXC:lLFvqV:hwzisofs-tools 1.0.6 %s: %s: %s%s: %s: %s %s: %s: Not a directory fzupxXCҭl˭LحFݭvqVhw֐}n_PD$ zisofs-tools 1.0.6 Usage: %s [options] intree outtree --force -f Always compress, even if result is larger --level # -z # Set compression level (1-9) --uncompress -u Uncompress an already compressed tree --parallelism # -p # Process up to # files in parallel --one-filesystem -x Do not cross filesystem boundaries --strict-one-filesystem -X Same as -x, but don't create stubs dirs --crib-tree -C Steal "crib" files from an old tree --local -l Do not recurse into subdirectoires --strict-local -L Same as -l, but don't create stubs dirs --file -F Operate possibly on a single file --sloppy -s Don't abort if metadata cannot be set --verbose -v Increase message verbosity --verbosity # -V # Set message verbosity to # (default = %d) --quiet -q No messages, not even errors (-V 0) --help -h Display this message --version -w Display the program version %s: invalid compression level: %d rbwbcrib: %s -> %s %s: mknod failed for %s: %s %s: hard link %s -> %s failed: %s %s: Failed to stat file %s: %s %s: symlink %s -> %s failed: %s %s: readlink failed for %s: %s %s: Failed to stat directory %s: %s %s: Cannot create output directory %s: %s %s: Failed to open directory %s: %s 7S;,zR| AB En  Th  p| oLoo҈:JZjzʋڋ *:JZjzʌڌ *:JZjzʍڍ   hmkzftree.debug3z.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.gnu_debuglink 44HH !hh' /7o҈xDoLL 0S || \  p e  `$$ k  4qTT-w- 6,,6<@@@@@@AH   B*  B4B