| Back to Build/check report for BioC 3.24: simplified long |
|
This page was generated on 2026-05-09 15:11 -0400 (Sat, 09 May 2026).
| Hostname | OS | Arch (*) | R version | Installed pkgs |
|---|---|---|---|---|
| nebbiolo2 | Linux (Ubuntu 24.04.4 LTS) | x86_64 | 4.6.0 RC (2026-04-17 r89917) -- "Because it was There" | 4890 |
| Click on any hostname to see more info about the system (e.g. compilers) (*) as reported by 'uname -p', except on Windows and Mac OS X | ||||
| Package 1654/2374 | Hostname | OS / Arch | INSTALL | BUILD | CHECK | BIOCCHECK | BUILD BIN | ||||||||
| procoil 2.41.0 (landing page) Ulrich Bodenhofer
| nebbiolo2 | Linux (Ubuntu 24.04.4 LTS) / x86_64 | OK | OK | OK | WARNINGS | |||||||||
| See other builds for procoil in R Universe. | |||||||||||||||
|
To the developers/maintainers of the procoil package: - Allow up to 24 hours (and sometimes 48 hours) for your latest push to git@git.bioconductor.org:packages/procoil.git to reflect on this report. See Troubleshooting Build Report for more information. - Use the following Renviron settings to reproduce errors and warnings. - If 'R CMD check' started to fail recently on the Linux builder(s) over a missing dependency, add the missing dependency to 'Suggests:' in your DESCRIPTION file. See Renviron.bioc for more information. |
| Package: procoil |
| Version: 2.41.0 |
| Command: /home/biocbuild/bbs-3.24-bioc/R/bin/Rscript -e "BiocCheck::BiocCheck('procoil_2.41.0.tar.gz','quit-with-status'=TRUE)" |
| StartedAt: 2026-05-09 07:25:49 -0400 (Sat, 09 May 2026) |
| EndedAt: 2026-05-09 07:26:32 -0400 (Sat, 09 May 2026) |
| EllapsedTime: 43.0 seconds |
| RetCode: 0 |
| Status: WARNINGS |
| CheckDir: None |
| Warnings: 1 |
##############################################################################
##############################################################################
###
### Running command:
###
### /home/biocbuild/bbs-3.24-bioc/R/bin/Rscript -e "BiocCheck::BiocCheck('procoil_2.41.0.tar.gz','quit-with-status'=TRUE)"
###
##############################################################################
##############################################################################
── Installing procoil ──────────────────────────────────────────────────────────
✔ Package installed successfully
── procoil session metadata ────────────────────────────────────────────────────
→ sourceDir: /tmp/RtmpQHrlyy/file10323f6c705eeb/procoil
→ BiocVersion: 3.24
→ Package: procoil
→ PackageVersion: 2.41.0
→ BiocCheckDir: /home/biocbuild/bbs-3.24-bioc/meat/procoil.BiocCheck
→ BiocCheckVersion: 1.49.4
→ sourceDir: /tmp/RtmpQHrlyy/file10323f6c705eeb/procoil
→ installDir: /tmp/RtmpQHrlyy/file10323ff6902f1
→ isTarBall: TRUE
→ platform: unix
── Running BiocCheck on procoil ────────────────────────────────────────────────
* Checking for deprecated package usage...
* Checking for remote package usage...
* Checking for 'LazyData: true' usage...
ℹ NOTE: 'LazyData:' in the 'DESCRIPTION' should be set to false or removed
* Checking version number...
* Checking for version number mismatch...
* Checking version number validity...
* Checking R version dependency...
ℹ NOTE: Update R version dependency from 3.3.0 to 4.6.0
* Checking package size...
* Checking individual file sizes...
* Checking biocViews...
* Checking that biocViews are present...
* Checking package type based on biocViews...
→ Software
* Checking for non-trivial biocViews...
* Checking that biocViews come from the same category...
* Checking biocViews validity...
* Checking for recommended biocViews...
ℹ NOTE: Consider adding these automatically suggested biocViews: Normalization,
KEGG, Clustering, Regression, GUI, GPU
ℹ Search 'biocViews' at https://contributions.bioconductor.org
* Checking build system compatibility...
* Checking for proper Description: field...
* Checking if DESCRIPTION is well formatted...
* Checking for whitespace in DESCRIPTION field names...
* Checking if 'Package:' field matches directory / tarball...
* Checking for Version: field...
ℹ NOTE: Consider adding the maintainer's ORCID iD in 'Authors@R' with
'comment=c(ORCID="...")'
* Checking License: for restrictive use...
* Checking for recommended DESCRIPTION fields...
ℹ NOTE: Provide 'BugReports' field(s) in DESCRIPTION
* Checking for Bioconductor software dependencies...
ℹ Bioconductor dependencies found in Imports & Depends (43%).
* Checking for pinned package versions in DESCRIPTION...
* Checking for 'fnd' role in Authors@R...
ℹ NOTE: No 'fnd' role found in Authors@R. If the work is supported by a grant,
consider adding the 'fnd' role to the list of authors.
* Checking NAMESPACE...
* Checking .Rbuildignore...
* Checking for stray BiocCheck output folders...
* Checking vignette directory...
! WARNING: Use RMarkdown instead of Sweave 'Rnw' vignettes.
Rnw vignette(s) found:
• procoil.Rnw
ℹ NOTE: 'sessionInfo' not found in vignette(s)
Missing from file(s):
• vignettes/procoil.Rnw
* Checking package installation calls in R code...
* Checking for library/require of procoil...
* Checking coding practice...
ℹ NOTE: Avoid sapply(); use vapply()
Found in files:
• R/predict-methods.R (line 85, column 23)
• R/predict-methods.R (line 86, column 23)
ℹ NOTE: Avoid 1:...; use seq_len() or seq_along()
Found in files:
• access-methods.R (line 21, column 23)
• ...
• show-methods.R (line 53, column 15)
ℹ NOTE: Avoid 'cat' and 'print' outside of 'show' methods
Found in files:
• cat() in R/show-methods.R (line 3, column 5)
• ...
• cat() in R/show-methods.R (line 102, column 5)
* Checking parsed R code in R directory, examples, vignettes...
* Checking function lengths...
ℹ NOTE: The recommended function length is 50 lines or less. There are 2
functions greater than 50 lines.
The longest 5 functions are:
• predict.CCModel() (R/predict-methods.R): 118 lines
• show.CCProfile() (R/show-methods.R): 76 lines
* Checking man page documentation...
ℹ NOTE: Usage of dontrun / donttest tags found in man page examples. 17% of man
pages use at least one of these tags.
Found in files:
• CCModel-FileOps.Rd
ℹ NOTE: Use donttest instead of dontrun.
Found in files:
• CCModel-FileOps.Rd
* Checking package NEWS...
* Checking unit tests...
ℹ NOTE: Consider adding unit tests. We strongly encourage them. See
https://contributions.bioconductor.org/tests.html
* Checking skip_on_bioc() in tests...
* Checking formatting of DESCRIPTION, NAMESPACE, man pages, R source, and
vignette source...
ℹ NOTE: Consider shorter lines; 50 lines (2%) are > 80 characters long.
First few lines:
• man/predict-methods.Rd#L113 "MGECDQLLVFMITSRVLVLSTLIIMDSRQVYLENLR ...
• ...
• vignettes/procoil.Rnw#L919 {\bf Annette Jacyszyn} who also performe ...
ℹ NOTE: Consider multiples of 4 spaces for line indents; 426 lines (19%) are
not.
First few lines:
• R/access-methods.R#L26 " all negative\ ...
• ...
• vignettes/procoil.Rnw#L1049 within protein structures. ...
ℹ See https://contributions.bioconductor.org/r-code.html
ℹ See styler package: https://cran.r-project.org/package=styler as described in
the BiocCheck vignette.
* Checking if package already exists in CRAN...
* Checking for bioc-devel mailing list subscription...
ℹ NOTE: Cannot determine whether maintainer is subscribed to the Bioc-Devel
mailing list (requires admin credentials). Subscribe here:
https://stat.ethz.ch/mailman/listinfo/bioc-devel
* Checking for support site registration...
ℹ Maintainer is registered at support site.
ℹ Package is in the Support Site Watched Tags.
── BiocCheck v1.49.4 results ───────────────────────────────────────────────────
✖ 0 ERRORS | ⚠ 1 WARNINGS | ℹ 17 NOTES
ℹ See the procoil.BiocCheck folder and run
browseVignettes(package = 'BiocCheck')
for details.